Diaphorina citri psyllid: psy3716

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------

MSTIVDPTVYLTAKQEAYSKNPEISAQWLNLEELYNKKLWHQLTLAVLAFVQNPAIQKEGELRDLYHKFVISFETKINPVSLMEIMEVITNHLSDQEEALVLLQSFEDKVKNNLEAKSLCKILQAQMIMNKDADKPGSLDEVEKLIDEIELLVNDIEGVTAIHSRFYLVASTLYRKQAKLSLYYRTALRYLGCVDLNDLTASDQVQHAFLIGLAALLADSVYNIGELLAHPILDSLQQTPNAWLVELLRAFNAGDIEKFELMRPQWSAMNDIKANENKLSQKIALLCLMELAFKKIPGSHQLSFAEISEAAQLPLIEVEFLIIKALALGLVKGHIDQVDESFNVTWVQPRVLSKDQLAFKKIPGSHQLSFAEISEAAQLPLIEVEFLIIKALALGLVKGHIDQVDESFNVTWVQPRVLSKDQVFWSLEETVATEVL

ccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccHHHccccHHHHHcccccHHHHHHHHHHccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccHHHHHHHHHHHHHccccCEEEcccccEEEEEEECcccccHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccHHHHHHHHHHHHccccc

****VDPTVYLTAKQEAYSKNPEISAQWLNLEELYNKKLWHQLTLAVLAFVQNPAIQKEGELRDLYHKFVISFETKINPVSLMEIMEVITNHLSDQEEALVLLQSFEDKVKNNLEAKSLCKILQAQMIMNKDADKPGSLDEVEKLIDEIELLVNDIEGVTAIHSRFYLVASTLYRKQAKLSLYYRTALRYLGCVDLNDLTASDQVQHAFLIGLAALLADSVYNIGELLAHPILDSLQQTPNAWLVELLRAFNAGDIEKFELMRPQWSAMNDIKANENKLSQKIALLCLMELAFKKIPGSHQLSFAEISEAAQLPLIEVEFLIIKALALGLVKGHIDQVDESFNVTWVQPRVLSKDQLAFKKIPGSHQLSFAEISEAAQLPLIEVEFLIIKALALGLVKGHIDQVDESFNVTWVQPRVLSKDQVFWSLEETVATEV*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSTIVDPTVYLTAKQEAYSKNPEISAQWLNLEELYNKKLWHQLTLAVLAFVQNPAIQKEGELRDLYHKFVISFETKINPVSLMEIMEVITNHLSDQEEALVLLQSFEDKVKNNLEAKSLCKILQAQMIMNKDADKPGSxxxxxxxxxxxxxxxxxxxxxTAIHSRFYLVASTLYRKQAKLSLYYRTALRYLGCVDLNDLTASDQVQHAFLIGLAALLADSVYNIGELLAHPILDSLQQTPNAWLVELLRAFNAGDIEKFELMRPQWSAMNDIKANENKLSQKIALLCLMELAFKKIPGSHQLSFAEISEAAQLPLIEVEFLIIKALALGLVKGHIDQVDESFNVTWVQPRVLSKDQLAFKKIPGSHQLSFAEISEAAQLPLIEVEFLIIKALALGLVKGHIDQVDESFNVTWVQPRVLSKDQVFWSLEETVATEVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
26S proteasome non-ATPase regulatory subunit 13	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	confident	Q54NQ0
Probable 26S proteasome regulatory subunit rpn9	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	confident	Q9US13
26S proteasome non-ATPase regulatory subunit 13	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	confident	P84169

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0034515 [CC]	proteasome storage granule	probable	GO:0043234, GO:0005737, GO:0032991, GO:0044445, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0031597, GO:0044424, GO:0000502
GO:0050789 [BP]	regulation of biological process	probable	GO:0008150, GO:0065007
GO:0006511 [BP]	ubiquitin-dependent protein catabolic process	probable	GO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0004175 [MF]	endopeptidase activity	probable	GO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0008541 [CC]	proteasome regulatory particle, lid subcomplex	probable	GO:0043234, GO:0005838, GO:0022624, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0000502, GO:0044424, GO:0032991

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain O
Confidence level:confident
Coverage over the Query: 8-344
View the alignment between query and template
View the model in PyMOL

Template: 3CHM, chain A
Confidence level:probable
Coverage over the Query: 196-354
View the alignment between query and template
View the model in PyMOL