Diaphorina citri psyllid: psy3721


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MSRFDQQQLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDEVVIGQKSVPVQAL
cccHHHHHHHHHcccccccccccccccccccccccccEEEccccccccHHHHHHHHHccccEEEEEEEccEEEEEEccHHHHHHHHHHHcccECccCEEEEccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcCEEEEcccHHHHHHHHHHccCECccCEEEEEEccccccccccHHHHHHcccccccccc
***********VSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLK****************VFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKV****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRFDQQQLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDEVVIGQKSVPVQAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding protein lark Essential RNA-binding protein. May be required for circadian repression of eclosion. Also essential for nurse cell dumping during oogenesis, the process whereby the cytoplasmic contents of nurse cells are transferred to the oocyte late in it's development.confidentQ94901

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0006417 [BP]regulation of translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0050793 [BP]regulation of developmental processprobableGO:0008150, GO:0065007, GO:0050789
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051252 [BP]regulation of RNA metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 31-183
View the alignment between query and template
View the model in PyMOL