Psyllid ID: psy3721


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MSRFDQQQLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDEVVIGQKSVPVQAL
ccHHHHHHHHHHcccccccccccccccccccccccccEEEccccccccHHHHHHHHHccccEEEEEEEccEEEEEEccHHHHHHHHHHHcccEEccEEEEEccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcEEEEEcccHHHHHHHHHHccEEEccEEEEEEEccccccccccHHHHHHcccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHcccccEEEEEEEEccEEEEcccHHHHHHHHHHHcccEccccEEEEEEEccccHHcccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEccEEEEcccHHHHHHHHHHcccEccccEEEEEEccccHHHHHHHHHHHHHHcccccccc
msrfdqqqLVKVSrysnnqiniscrnmpgfssvgTFKIFignvnpgtsvELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNgqivnekplkieaatsrkgpntpttkvfvgnlsdntrapevrelfvpygtvvecdivrnygfvhidspdINKCIKElngmmvdgkpmkvqistsrvrqrpgvdevvigqksvpvqal
msrfdqqqLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKElngqivnekplkieaatsrkgpntpttkvfvgnlsdntrapEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVQistsrvrqrpgvdevvigqksvpvqal
MSRFDQQQLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDEVVIGQKSVPVQAL
***********VSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMEN**************************************VFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVD**********************************
*************************************IFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLK*****************FVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKV****************************
MSRFDQQQLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKV***********GVDEVVIGQKSVPVQAL
*SRFDQQQLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDEVVIGQK*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRFDQQQLVKVSRYSNNQINISCRNMPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSPDINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDEVVIGQKSVPVQAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
Q94901 352 RNA-binding protein lark yes N/A 0.797 0.468 0.668 8e-61
Q6IQ97 419 RNA-binding protein 4.1 O yes N/A 0.748 0.369 0.446 1e-32
Q8C7Q4 361 RNA-binding protein 4 OS= yes N/A 0.739 0.423 0.426 2e-30
Q4R979 364 RNA-binding protein 4 OS= N/A N/A 0.739 0.420 0.426 2e-30
Q9BWF3 364 RNA-binding protein 4 OS= yes N/A 0.739 0.420 0.426 2e-30
Q9BDY9 359 RNA-binding protein 4 OS= no N/A 0.739 0.426 0.426 2e-30
Q64LC9 357 RNA-binding protein 4B OS yes N/A 0.739 0.428 0.426 3e-30
Q8VE92 357 RNA-binding protein 4B OS no N/A 0.739 0.428 0.426 3e-30
Q9BQ04 359 RNA-binding protein 4B OS no N/A 0.739 0.426 0.426 3e-30
Q3MHX3 362 RNA-binding protein 4 OS= yes N/A 0.739 0.422 0.426 3e-30
>sp|Q94901|LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster GN=lark PE=1 SV=1 Back     alignment and function desciption
 Score =  233 bits (593), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/169 (66%), Positives = 136/169 (80%), Gaps = 4/169 (2%)

Query: 27  MPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAI 86
           MPG    GTFK+FIGN++  T    +R LFEKYG VVECDVVKNYGFVHME +++GR AI
Sbjct: 1   MPG---AGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAI 57

Query: 87  KELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDI 146
           + LNG  +NE  +K+EAA SR+ PNTPTTK+FVGNL+D TRAPEVRELF  YGTVVECDI
Sbjct: 58  QNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDI 117

Query: 147 VRNYGFVHIDS-PDINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDE 194
           VRNYGFVH+D   D+   IKELNG +VDG+P+KVQ+STSRVR +PG+ +
Sbjct: 118 VRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGD 166




Essential RNA-binding protein. May be required for circadian repression of eclosion. Also essential for nurse cell dumping during oogenesis, the process whereby the cytoplasmic contents of nurse cells are transferred to the oocyte late in it's development.
Drosophila melanogaster (taxid: 7227)
>sp|Q6IQ97|RBM41_DANRE RNA-binding protein 4.1 OS=Danio rerio GN=rbm4.1 PE=1 SV=1 Back     alignment and function description
>sp|Q8C7Q4|RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus GN=Rbm4 PE=1 SV=1 Back     alignment and function description
>sp|Q4R979|RBM4_MACFA RNA-binding protein 4 OS=Macaca fascicularis GN=RBM4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens GN=RBM4 PE=1 SV=1 Back     alignment and function description
>sp|Q9BDY9|RBM4_RABIT RNA-binding protein 4 OS=Oryctolagus cuniculus GN=RBM4 PE=2 SV=1 Back     alignment and function description
>sp|Q64LC9|RBM4B_RAT RNA-binding protein 4B OS=Rattus norvegicus GN=Rbm4b PE=2 SV=2 Back     alignment and function description
>sp|Q8VE92|RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus GN=Rbm4b PE=1 SV=1 Back     alignment and function description
>sp|Q9BQ04|RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens GN=RBM4B PE=1 SV=1 Back     alignment and function description
>sp|Q3MHX3|RBM4_BOVIN RNA-binding protein 4 OS=Bos taurus GN=RBM4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
383848340 351 PREDICTED: RNA-binding protein lark-like 0.811 0.478 0.775 2e-70
350416927 458 PREDICTED: LOW QUALITY PROTEIN: RNA-bind 0.917 0.414 0.701 2e-70
332031363 355 RNA-binding protein lark [Acromyrmex ech 0.811 0.473 0.757 2e-69
322797564 324 hypothetical protein SINV_13630 [Solenop 0.811 0.518 0.757 8e-69
307187784 331 RNA-binding protein lark [Camponotus flo 0.811 0.507 0.757 9e-69
307195687 325 RNA-binding protein lark [Harpegnathos s 0.811 0.516 0.757 1e-68
91088839 358 PREDICTED: similar to lark CG8597-PA [Tr 0.811 0.469 0.733 2e-68
380021805 351 PREDICTED: RNA-binding protein lark-like 0.811 0.478 0.751 6e-68
328786023 356 PREDICTED: RNA-binding protein lark-like 0.811 0.471 0.751 2e-67
332377011 356 unknown [Dendroctonus ponderosae] 0.801 0.466 0.724 3e-67
>gi|383848340|ref|XP_003699809.1| PREDICTED: RNA-binding protein lark-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 131/169 (77%), Positives = 149/169 (88%), Gaps = 1/169 (0%)

Query: 27  MPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAI 86
           MPGFSSVGTFKIFIGN+   TS   I+PLFEKYGKVVECDVVKNYGFVHMEN+E GR AI
Sbjct: 1   MPGFSSVGTFKIFIGNLADKTSNADIKPLFEKYGKVVECDVVKNYGFVHMENEEAGRNAI 60

Query: 87  KELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDI 146
           + LNGQIV+ +P+K EAA SRKGPNTPTTK+FVGNL+DNT+AP+VRELF  YGTVVECDI
Sbjct: 61  QNLNGQIVHGQPIKCEAAKSRKGPNTPTTKIFVGNLTDNTKAPQVRELFAKYGTVVECDI 120

Query: 147 VRNYGFVHIDSP-DINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDE 194
           VRNYGFVH+++  D+N  IKELNG MVDG+PMKVQISTSRVRQRPG+ +
Sbjct: 121 VRNYGFVHLEATGDVNDAIKELNGQMVDGQPMKVQISTSRVRQRPGMGD 169




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350416927|ref|XP_003491172.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein lark-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332031363|gb|EGI70876.1| RNA-binding protein lark [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322797564|gb|EFZ19608.1| hypothetical protein SINV_13630 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307187784|gb|EFN72750.1| RNA-binding protein lark [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307195687|gb|EFN77529.1| RNA-binding protein lark [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91088839|ref|XP_970745.1| PREDICTED: similar to lark CG8597-PA [Tribolium castaneum] gi|270012337|gb|EFA08785.1| hypothetical protein TcasGA2_TC006476 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380021805|ref|XP_003694747.1| PREDICTED: RNA-binding protein lark-like [Apis florea] Back     alignment and taxonomy information
>gi|328786023|ref|XP_623841.3| PREDICTED: RNA-binding protein lark-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|332377011|gb|AEE63645.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
FB|FBgn0011640 352 lark "lark" [Drosophila melano 0.797 0.468 0.668 5.1e-58
ZFIN|ZDB-GENE-030131-3902 419 rbm4.1 "RNA binding motif prot 0.748 0.369 0.446 2.9e-32
ZFIN|ZDB-GENE-040426-1811 331 zgc:77262 "zgc:77262" [Danio r 0.700 0.438 0.449 1.3e-29
UNIPROTKB|H9L1A3 306 LOC100859076 "Uncharacterized 0.748 0.506 0.421 1.6e-29
UNIPROTKB|Q2KIV3 359 RBM4B "Uncharacterized protein 0.748 0.431 0.421 2.1e-29
UNIPROTKB|E2RSD7 359 RBM4B "Uncharacterized protein 0.748 0.431 0.421 2.1e-29
UNIPROTKB|Q9BQ04 359 RBM4B "RNA-binding protein 4B" 0.748 0.431 0.421 2.1e-29
UNIPROTKB|Q06AT9 359 RBM4B "RNA-binding protein 4B" 0.748 0.431 0.421 2.1e-29
UNIPROTKB|Q9BDY9 359 RBM4 "RNA-binding protein 4" [ 0.748 0.431 0.421 2.1e-29
MGI|MGI:1913954 357 Rbm4b "RNA binding motif prote 0.748 0.434 0.421 2.1e-29
FB|FBgn0011640 lark "lark" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 596 (214.9 bits), Expect = 5.1e-58, P = 5.1e-58
 Identities = 113/169 (66%), Positives = 136/169 (80%)

Query:    27 MPGFSSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAI 86
             MPG    GTFK+FIGN++  T    +R LFEKYG VVECDVVKNYGFVHME +++GR AI
Sbjct:     1 MPG---AGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAI 57

Query:    87 KELNGQIVNEKPLKIEAATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDI 146
             + LNG  +NE  +K+EAA SR+ PNTPTTK+FVGNL+D TRAPEVRELF  YGTVVECDI
Sbjct:    58 QNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDI 117

Query:   147 VRNYGFVHIDSP-DINKCIKELNGMMVDGKPMKVQISTSRVRQRPGVDE 194
             VRNYGFVH+D   D+   IKELNG +VDG+P+KVQ+STSRVR +PG+ +
Sbjct:   118 VRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGD 166


GO:0009790 "embryo development" evidence=IMP
GO:0008062 "eclosion rhythm" evidence=NAS;IMP;TAS
GO:0007623 "circadian rhythm" evidence=NAS;IMP
GO:0045804 "negative regulation of eclosion" evidence=IMP
GO:0003729 "mRNA binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0045475 "locomotor rhythm" evidence=IMP;TAS
GO:0007562 "eclosion" evidence=TAS
GO:0040011 "locomotion" evidence=TAS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0048477 "oogenesis" evidence=IMP
GO:0003723 "RNA binding" evidence=NAS
GO:0007303 "cytoplasmic transport, nurse cell to oocyte" evidence=IMP
GO:0008104 "protein localization" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0071011 "precatalytic spliceosome" evidence=IDA
ZFIN|ZDB-GENE-030131-3902 rbm4.1 "RNA binding motif protein 4.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1811 zgc:77262 "zgc:77262" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L1A3 LOC100859076 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIV3 RBM4B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSD7 RBM4B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ04 RBM4B "RNA-binding protein 4B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q06AT9 RBM4B "RNA-binding protein 4B" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BDY9 RBM4 "RNA-binding protein 4" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:1913954 Rbm4b "RNA binding motif protein 4B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94901LARK_DROMENo assigned EC number0.66860.79710.4687yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 4e-28
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 4e-26
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 3e-21
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 9e-19
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 5e-17
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 2e-16
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-16
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-16
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-15
smart0036073 smart00360, RRM, RNA recognition motif 5e-15
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 7e-15
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-14
smart0036073 smart00360, RRM, RNA recognition motif 2e-14
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-14
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-13
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 1e-13
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 7e-13
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 2e-12
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 7e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-11
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 7e-11
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-10
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 1e-10
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 1e-10
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 1e-10
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 5e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 8e-10
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-09
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-09
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-09
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 3e-09
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 5e-09
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 6e-09
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 7e-09
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-08
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 1e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-08
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-08
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-08
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-08
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-08
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-08
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 4e-08
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-08
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 6e-08
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 7e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 9e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-07
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 1e-07
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-07
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 2e-07
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 3e-07
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 3e-07
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-07
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 3e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 5e-07
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 6e-07
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 6e-07
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 6e-07
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 7e-07
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 8e-07
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 8e-07
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 8e-07
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 9e-07
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 9e-07
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-06
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-06
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 1e-06
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 1e-06
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 1e-06
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-06
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 1e-06
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-06
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 2e-06
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 2e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-06
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-06
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 3e-06
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 3e-06
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 4e-06
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 4e-06
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-06
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 5e-06
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 5e-06
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 5e-06
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 6e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 6e-06
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 6e-06
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 7e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 7e-06
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 8e-06
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 8e-06
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 8e-06
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 9e-06
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 9e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 9e-06
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 1e-05
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 1e-05
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 1e-05
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-05
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 1e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-05
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-05
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-05
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 2e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 2e-05
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-05
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 2e-05
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 2e-05
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-05
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 3e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 3e-05
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 3e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 3e-05
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 3e-05
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-05
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 4e-05
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 4e-05
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 4e-05
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 4e-05
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 5e-05
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 5e-05
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 6e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 7e-05
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 7e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 7e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 7e-05
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 7e-05
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 7e-05
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 7e-05
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 8e-05
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 9e-05
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 9e-05
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 1e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 1e-04
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 1e-04
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 1e-04
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 1e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 1e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 1e-04
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 1e-04
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 2e-04
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 2e-04
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-04
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 2e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 2e-04
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 2e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-04
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 2e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 2e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-04
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2e-04
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 2e-04
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 2e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-04
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-04
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 3e-04
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 4e-04
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 4e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 5e-04
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 5e-04
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 5e-04
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 5e-04
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 5e-04
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 5e-04
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 5e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 6e-04
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 6e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 6e-04
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 6e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 6e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 6e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 6e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 6e-04
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 6e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 7e-04
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 7e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 7e-04
cd1262677 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in 7e-04
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 8e-04
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 8e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 8e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.001
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 0.001
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 0.001
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 0.001
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 0.001
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 0.001
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 0.001
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 0.001
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.001
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 0.001
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 0.001
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 0.001
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 0.001
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 0.002
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 0.002
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 0.002
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.002
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.002
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.002
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 0.002
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 0.002
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.002
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.002
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 0.002
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 0.002
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 0.002
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 0.002
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.002
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 0.002
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 0.002
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 0.002
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 0.002
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 0.002
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 0.003
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.003
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 0.003
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 0.003
cd12287102 cd12287, RRM_U2AF35_like, RNA recognition motif in 0.003
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 0.003
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.003
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 0.003
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.003
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 0.003
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 0.003
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 0.003
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 0.004
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 0.004
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 0.004
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 0.004
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 0.004
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 0.004
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 0.004
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 0.004
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 0.004
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
 Score =  100 bits (251), Expect = 4e-28
 Identities = 37/66 (56%), Positives = 46/66 (69%)

Query: 37  KIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELNGQIVNE 96
           K+F+GN+   T+ E +R LFEKYG V ECDVVKNYGFVHME +E+   AIK LNG     
Sbjct: 1   KLFVGNLPDATTSEELRALFEKYGTVTECDVVKNYGFVHMEEEEDAEDAIKALNGYEFMG 60

Query: 97  KPLKIE 102
           K + +E
Sbjct: 61  KRINVE 66


This subfamily corresponds to the RRM in CoAA (also known as RBM14 or PSP2) and RNA-binding protein 4 (RBM4). CoAA is a heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein identified as a nuclear receptor coactivator. It mediates transcriptional coactivation and RNA splicing effects in a promoter-preferential manner, and is enhanced by thyroid hormone receptor-binding protein (TRBP). CoAA contains two N-terminal RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a TRBP-interacting domain. RBM4 is a ubiquitously expressed splicing factor with two isoforms, RBM4A (also known as Lark homolog) and RBM4B (also known as RBM30), which are very similar in structure and sequence. RBM4 may also function as a translational regulator of stress-associated mRNAs as well as play a role in micro-RNA-mediated gene regulation. RBM4 contains two N-terminal RRMs, a CCHC-type zinc finger, and three alanine-rich regions within their C-terminal regions. This family also includes Drosophila RNA-binding protein lark (Dlark), a homolog of human RBM4. It plays an important role in embryonic development and in the circadian regulation of adult eclosion. Dlark shares high sequence similarity with RBM4 at the N-terminal region. However, Dlark has three proline-rich segments instead of three alanine-rich segments within the C-terminal region. . Length = 66

>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241070 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2) Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.98
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.97
KOG0148|consensus321 99.97
KOG0109|consensus 346 99.97
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.97
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.96
KOG0117|consensus 506 99.96
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.95
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.95
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.95
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.95
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.95
KOG0131|consensus203 99.95
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.95
KOG0144|consensus 510 99.95
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.94
KOG0145|consensus 360 99.93
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.92
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.91
KOG0127|consensus 678 99.91
KOG0124|consensus 544 99.9
KOG0145|consensus360 99.9
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.89
KOG0110|consensus725 99.87
KOG0127|consensus 678 99.87
KOG0123|consensus 369 99.87
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.82
KOG0148|consensus 321 99.82
KOG0105|consensus241 99.8
KOG0144|consensus510 99.8
KOG0146|consensus371 99.8
KOG0123|consensus 369 99.78
KOG4206|consensus221 99.78
KOG0106|consensus216 99.76
KOG4205|consensus 311 99.75
KOG1457|consensus284 99.74
KOG0110|consensus 725 99.73
KOG0147|consensus 549 99.72
KOG0124|consensus544 99.7
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.7
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.68
KOG1190|consensus492 99.67
KOG0147|consensus549 99.65
KOG4211|consensus 510 99.62
KOG1190|consensus492 99.62
KOG0107|consensus195 99.6
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.58
KOG4212|consensus 608 99.57
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.56
KOG1548|consensus382 99.55
PLN03120260 nucleic acid binding protein; Provisional 99.5
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.5
KOG0125|consensus 376 99.49
KOG0107|consensus195 99.49
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.46
KOG0125|consensus 376 99.45
PLN03120 260 nucleic acid binding protein; Provisional 99.45
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.44
KOG0120|consensus500 99.43
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.43
KOG0114|consensus124 99.42
KOG0121|consensus153 99.42
KOG0122|consensus270 99.4
KOG0109|consensus 346 99.36
PLN03121243 nucleic acid binding protein; Provisional 99.36
smart0036272 RRM_2 RNA recognition motif. 99.36
KOG0114|consensus124 99.35
PLN03213 759 repressor of silencing 3; Provisional 99.34
KOG0121|consensus153 99.34
KOG0117|consensus506 99.33
PLN03213 759 repressor of silencing 3; Provisional 99.32
smart0036272 RRM_2 RNA recognition motif. 99.32
KOG0122|consensus270 99.32
KOG0111|consensus 298 99.32
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.31
KOG4207|consensus256 99.31
KOG4207|consensus 256 99.31
KOG1456|consensus 494 99.3
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.29
KOG0113|consensus335 99.29
PLN03121 243 nucleic acid binding protein; Provisional 99.29
KOG0105|consensus 241 99.28
KOG0130|consensus170 99.28
KOG0130|consensus170 99.27
KOG4212|consensus608 99.27
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.25
KOG1456|consensus 494 99.25
KOG0149|consensus 247 99.24
smart0036071 RRM RNA recognition motif. 99.23
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.23
KOG0120|consensus 500 99.2
smart0036071 RRM RNA recognition motif. 99.2
KOG0132|consensus 894 99.19
KOG0113|consensus 335 99.17
KOG0111|consensus 298 99.17
KOG0153|consensus377 99.16
KOG0129|consensus520 99.16
KOG0149|consensus247 99.15
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.12
KOG0108|consensus 435 99.12
KOG4206|consensus 221 99.11
KOG0112|consensus 975 99.1
KOG0108|consensus 435 99.09
KOG0131|consensus203 99.09
KOG0126|consensus219 99.08
KOG0126|consensus219 99.07
KOG4211|consensus 510 99.07
KOG0132|consensus 894 98.99
KOG1365|consensus 508 98.96
KOG0128|consensus881 98.96
KOG4454|consensus267 98.96
KOG0153|consensus377 98.94
smart0036170 RRM_1 RNA recognition motif. 98.94
KOG4660|consensus 549 98.9
KOG0146|consensus 371 98.89
smart0036170 RRM_1 RNA recognition motif. 98.89
KOG1457|consensus 284 98.87
KOG0415|consensus479 98.85
KOG2193|consensus 584 98.84
KOG0415|consensus 479 98.76
KOG0151|consensus 877 98.74
KOG4661|consensus 940 98.71
KOG0106|consensus 216 98.71
KOG0226|consensus290 98.64
KOG4208|consensus214 98.62
KOG4661|consensus 940 98.61
KOG4210|consensus285 98.59
KOG4208|consensus214 98.56
KOG1365|consensus 508 98.56
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.55
KOG0533|consensus243 98.51
KOG0151|consensus 877 98.49
KOG0533|consensus243 98.44
KOG4205|consensus311 98.43
KOG4660|consensus 549 98.4
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.36
KOG0116|consensus419 98.33
KOG0116|consensus419 98.3
KOG4209|consensus231 98.27
KOG4307|consensus 944 98.23
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.22
KOG4676|consensus 479 98.18
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.17
KOG4209|consensus231 98.16
KOG1548|consensus 382 98.08
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.99
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.88
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.82
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.8
KOG4454|consensus 267 97.78
KOG0226|consensus290 97.68
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.57
KOG3152|consensus278 97.53
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.43
KOG3152|consensus278 97.43
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 97.37
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.37
KOG4307|consensus944 97.26
KOG1855|consensus 484 97.24
KOG0128|consensus 881 97.15
KOG1855|consensus484 97.14
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.08
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.02
KOG0112|consensus 975 97.02
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.0
KOG2314|consensus 698 96.99
KOG1996|consensus378 96.9
KOG2416|consensus 718 96.78
KOG1995|consensus351 96.68
KOG2193|consensus 584 96.62
KOG1995|consensus 351 96.61
KOG0115|consensus 275 96.52
KOG4849|consensus 498 96.29
KOG4210|consensus285 96.26
KOG1996|consensus378 96.26
KOG0129|consensus520 96.26
KOG2202|consensus260 96.23
KOG2202|consensus260 96.07
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 96.0
KOG2314|consensus 698 95.98
KOG4676|consensus 479 95.93
KOG2416|consensus718 95.89
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.83
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.82
KOG2591|consensus 684 95.82
KOG2591|consensus 684 95.79
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.62
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 95.6
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.54
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 95.48
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.36
KOG4849|consensus 498 95.32
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.25
KOG2135|consensus526 95.18
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.11
KOG2135|consensus526 94.52
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.18
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 94.13
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 94.0
KOG2253|consensus 668 93.86
KOG4574|consensus 1007 93.68
KOG2068|consensus 327 93.57
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 93.37
KOG0115|consensus275 92.54
KOG0804|consensus 493 92.19
PF14111153 DUF4283: Domain of unknown function (DUF4283) 91.86
KOG4285|consensus350 90.98
KOG0804|consensus 493 90.95
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 90.79
KOG2068|consensus327 90.76
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 89.52
KOG4285|consensus350 89.35
KOG2253|consensus 668 88.98
KOG4574|consensus 1007 86.21
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 84.26
KOG2891|consensus 445 80.32
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=99.98  E-value=4.1e-31  Score=219.62  Aligned_cols=155  Identities=23%  Similarity=0.472  Sum_probs=140.2

Q ss_pred             CCCcccEEEcCCCCCCCHHHHHHHhhcCCceEEEEEE--------CCEEEEEeCChHHHHHHHHHhcCCeeCCeeeEEEE
Q psy3721          32 SVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVV--------KNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEA  103 (207)
Q Consensus        32 ~~~~~~l~V~~lp~~~t~~~l~~~f~~~g~i~~i~~~--------~~~~fV~f~~~~~a~~a~~~l~~~~~~g~~i~v~~  103 (207)
                      ....++|||+|||+++|+++|+++|+.||+|.+++++        ++||||+|.++++|++|++.|++..+.++.|+|.+
T Consensus       104 ~~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~gr~i~V~~  183 (346)
T TIGR01659       104 NNSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVRNKRLKVSY  183 (346)
T ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccCCceeeeec
Confidence            3467899999999999999999999999999999886        47999999999999999999999999999999999


Q ss_pred             cccCCCCCCCCceeeecCCCCCCChhHHHHhcccCCcEEEEEEe--------cCEEEEEEcc-HhHHHHHHHhCCceeCC
Q psy3721         104 ATSRKGPNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIV--------RNYGFVHIDS-PDINKCIKELNGMMVDG  174 (207)
Q Consensus       104 ~~~~~~~~~~~~~l~v~nl~~~~t~~~l~~~f~~~g~i~~~~~~--------~~~afv~f~~-e~a~~A~~~l~g~~~~g  174 (207)
                      +.+... .....+|||+|||.++++++|+++|+.||.|+.++++        +++|||+|.+ ++|.+|+..||+..+.+
T Consensus       184 a~p~~~-~~~~~~lfV~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~~~g  262 (346)
T TIGR01659       184 ARPGGE-SIKDTNLYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKREEAQEAISALNNVIPEG  262 (346)
T ss_pred             cccccc-ccccceeEEeCCCCcccHHHHHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCHHHHHHHHHHhCCCccCC
Confidence            875432 2345689999999999999999999999999999987        4699999999 99999999999999866


Q ss_pred             --eeEEEEeccCccC
Q psy3721         175 --KPMKVQISTSRVR  187 (207)
Q Consensus       175 --~~i~v~~~~~~~~  187 (207)
                        ++|+|.++.+..+
T Consensus       263 ~~~~l~V~~a~~~~~  277 (346)
T TIGR01659       263 GSQPLTVRLAEEHGK  277 (346)
T ss_pred             CceeEEEEECCcccc
Confidence              7999999987644



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2891|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 3e-17
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 7e-13
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 5e-13
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 1e-10
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 1e-12
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 2e-09
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-09
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 3e-09
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 4e-09
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 4e-09
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 4e-09
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 4e-09
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 1e-08
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 2e-08
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 2e-08
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 3e-07
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 4e-07
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 5e-07
1wf1_A110 Solution Structure Of Rrm Domain In Rna-Binding Pro 6e-07
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 7e-07
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-06
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 2e-06
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 7e-04
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-06
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-04
1wf2_A98 Solution Structure Of Rrm Domain In Hnrpc Protein L 3e-06
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 5e-06
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 6e-06
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 1e-05
3sde_A 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-04
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-05
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 1e-05
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-05
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 2e-05
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 2e-05
1fje_B175 Solution Structure Of Nucleolin Rbd12 In Complex Wi 3e-05
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 3e-05
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 6e-05
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 3e-05
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 3e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 4e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 8e-04
2cpj_A99 Solution Structure Of The N-Terminal Rna Recognitio 4e-05
2cpj_A99 Solution Structure Of The N-Terminal Rna Recognitio 2e-04
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 5e-05
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 6e-05
3sde_B 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-04
2l41_A77 Nab3 Rrm - Ucuu Complex Length = 77 6e-05
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 6e-05
2kvi_A96 Structure Of Nab3 Rrm Length = 96 8e-05
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 9e-05
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 9e-04
2cpd_A99 Solution Structure Of The Rna Recognition Motif Of 1e-04
2xnq_A97 Structural Insights Into Cis Element Recognition Of 1e-04
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 2e-04
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 2e-04
1no8_A106 Solution Structure Of The Nuclear Factor Aly Rbd Do 3e-04
2i2y_A150 Solution Structure Of The Rrm Of Srp20 Bound To The 3e-04
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 4e-04
2xnr_A97 Structural Insights Into Cis Element Recognition Of 4e-04
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 4e-04
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 6e-04
2hvz_A101 Solution Structure Of The Rrm Domain Of Sr Rich Fac 8e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 9e-04
2i38_A150 Solution Structure Of The Rrm Of Srp20 Length = 150 9e-04
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure

Iteration: 1

Score = 84.7 bits (208), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 37/85 (43%), Positives = 59/85 (69%) Query: 31 SSVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVVKNYGFVHMENDEEGRTAIKELN 90 SS T+KIF+GNV+ + + +R LFE+ G+V+ECDVVK+Y FVHME + + + AI +LN Sbjct: 5 SSGNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLN 64 Query: 91 GQIVNEKPLKIEAATSRKGPNTPTT 115 G+ V K + +E +T + + P++ Sbjct: 65 GKEVKGKRINVELSTKGQKKSGPSS 89
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|1WF1|A Chain A, Solution Structure Of Rrm Domain In Rna-Binding Protein Np_057951 Length = 110 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1WF2|A Chain A, Solution Structure Of Rrm Domain In Hnrpc Protein Length = 98 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2CPJ|A Chain A, Solution Structure Of The N-Terminal Rna Recognition Motif Of Nono Length = 99 Back     alignment and structure
>pdb|2CPJ|A Chain A, Solution Structure Of The N-Terminal Rna Recognition Motif Of Nono Length = 99 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2L41|A Chain A, Nab3 Rrm - Ucuu Complex Length = 77 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2KVI|A Chain A, Structure Of Nab3 Rrm Length = 96 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2CPD|A Chain A, Solution Structure Of The Rna Recognition Motif Of Human Apobec-1 Complementation Factor, Acf Length = 99 Back     alignment and structure
>pdb|2XNQ|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|1NO8|A Chain A, Solution Structure Of The Nuclear Factor Aly Rbd Domain Length = 106 Back     alignment and structure
>pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2XNR|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-36
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 8e-20
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 7e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-36
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-13
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-36
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-14
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-35
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-15
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-34
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-15
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-14
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-34
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-34
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-15
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-34
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-15
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-10
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-33
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-15
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-12
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 5e-33
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 7e-16
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-11
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-32
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-14
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-10
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-31
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-29
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-11
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-30
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-19
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-30
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 8e-11
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-30
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-25
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-29
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 4e-28
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 7e-21
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-28
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-26
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-25
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 6e-10
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-25
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 7e-25
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-24
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 8e-21
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-23
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 7e-16
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-23
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-09
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-22
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-20
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-21
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-19
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 3e-20
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-20
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-20
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-20
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 5e-20
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 8e-20
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-17
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-19
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-18
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-19
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-15
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 3e-19
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-17
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 4e-19
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 9e-18
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-19
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-17
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-19
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-16
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-18
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-15
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-18
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 6e-17
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-18
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-16
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 4e-18
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 9e-17
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-18
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-18
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-16
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 7e-18
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-15
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-17
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-17
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-16
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-17
2f3j_A177 RNA and export factor binding protein 2; RRM domai 8e-15
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-17
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-17
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-13
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-17
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 6e-17
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-17
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-16
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-17
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 8e-17
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-17
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-14
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-17
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-17
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 4e-17
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-17
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-17
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 7e-09
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-08
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 5e-17
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-16
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 7e-17
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-14
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 7e-17
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-16
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 8e-17
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-16
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 9e-17
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-15
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-16
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-15
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-16
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-14
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-16
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-12
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-16
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-14
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-16
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 6e-16
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-16
1x5o_A114 RNA binding motif, single-stranded interacting pro 7e-15
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-16
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-15
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 3e-16
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 5e-12
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-16
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 6e-16
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-16
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 5e-16
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-15
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-16
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-12
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-16
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 7e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 6e-16
1x4e_A85 RNA binding motif, single-stranded interacting pro 6e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 7e-16
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-15
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 8e-16
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-14
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 9e-16
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-15
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-15
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-15
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-15
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-11
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-15
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-15
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-15
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-14
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-15
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-14
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-15
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 7e-12
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 5e-15
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-15
2cqd_A116 RNA-binding region containing protein 1; RNA recog 6e-15
2cqd_A116 RNA-binding region containing protein 1; RNA recog 9e-12
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 6e-15
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 6e-15
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 7e-15
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-14
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 7e-15
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-14
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 7e-15
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 7e-13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-14
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-13
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-14
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-14
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-14
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 4e-14
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 7e-14
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-13
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 9e-14
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-12
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-13
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-13
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-13
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-12
1x5p_A97 Negative elongation factor E; structure genomics, 2e-13
1x5p_A97 Negative elongation factor E; structure genomics, 2e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-13
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-13
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 4e-12
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 4e-13
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-13
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-09
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 5e-13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-12
3q2s_C229 Cleavage and polyadenylation specificity factor S; 6e-13
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-12
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-13
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-09
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-08
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-12
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 5e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-12
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-12
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 9e-12
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-12
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-12
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-12
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-12
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 4e-12
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 5e-11
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 4e-12
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-11
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 4e-12
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 7e-12
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-12
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-12
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-10
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-12
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-09
3n9u_C156 Cleavage and polyadenylation specificity factor S; 6e-12
3n9u_C156 Cleavage and polyadenylation specificity factor S; 8e-12
3p5t_L90 Cleavage and polyadenylation specificity factor S; 6e-12
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-10
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 9e-12
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 9e-12
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-11
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-11
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-11
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-11
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-08
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-11
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 9e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 4e-11
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 6e-10
2la6_A99 RNA-binding protein FUS; structural genomics, nort 9e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-09
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 1e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-08
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-10
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 5e-09
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-10
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-09
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 7e-10
2div_A99 TRNA selenocysteine associated protein; structural 6e-10
2div_A99 TRNA selenocysteine associated protein; structural 2e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-10
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-08
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-09
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-09
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-09
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-09
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-09
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-07
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 6e-09
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 7e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-07
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-08
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-08
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-07
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-08
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-08
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-08
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-08
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-08
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-06
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-04
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 7e-05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-06
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-06
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 4e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-05
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 4e-05
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 9e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 4e-04
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 4e-04
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 4e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 6e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-04
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
 Score =  125 bits (317), Expect = 2e-36
 Identities = 23/176 (13%), Positives = 70/176 (39%), Gaps = 27/176 (15%)

Query: 37  KIFIGNVNPGTSVELIRPLFEKYGKVVECDVV--------KNYGFVHMENDEEGRTAIKE 88
           ++++G++      + IR  F  +G +   D+         K + FV  E  E  + A+++
Sbjct: 30  RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQ 89

Query: 89  LNGQIVNEKPLKIEAATSRK----------GPNTPTTKVFVGNLSDNTRAPEVRELFVPY 138
           +N  ++  + +K+   ++                   +++V ++  +    +++ +F  +
Sbjct: 90  MNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAF 149

Query: 139 GTVVECDIV--------RNYGFVHIDSP-DINKCIKELNGMMVDGKPMKVQISTSR 185
           G +    +         + YGF+  +        +  +N   + G+ ++V  + + 
Sbjct: 150 GKIKSATLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTP 205


>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Length = 345 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 100.0
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 100.0
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 100.0
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.98
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.98
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.98
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.97
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.97
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.97
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.88
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.87
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.87
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.8
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.8
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.79
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.79
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.78
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.78
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.77
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.77
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.77
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.77
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.77
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.77
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.77
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.77
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.77
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.77
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.76
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.76
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.76
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.76
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.76
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.76
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.76
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.76
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.76
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.76
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.76
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.76
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.76
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.75
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.75
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.75
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.75
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.75
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.75
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.75
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.75
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.75
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.75
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.75
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.75
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.74
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.74
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.74
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.74
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.74
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.74
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.74
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.74
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.74
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.74
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.74
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.74
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.74
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.74
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.74
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.74
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.74
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.74
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.74
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.73
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.73
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.73
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.73
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.73
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.73
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.73
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.73
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.73
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.73
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.73
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.73
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.73
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.73
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.73
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.73
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.73
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.73
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.73
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.73
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.73
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.73
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.73
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.73
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.73
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.73
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.72
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.72
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.72
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.72
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.72
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.72
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.72
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.72
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.72
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.72
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.72
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.72
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.72
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.72
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.72
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.72
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.72
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.72
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.72
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.72
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.72
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.72
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.71
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.71
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.71
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.71
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.71
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.71
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.71
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.71
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.71
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.71
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.71
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.71
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.71
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.71
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.71
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.71
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.71
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.71
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.71
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.71
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.7
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.7
1x5p_A97 Negative elongation factor E; structure genomics, 99.7
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.7
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.7
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.7
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.7
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.7
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.7
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.7
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.7
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.7
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.7
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.7
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.7
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.7
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.7
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.7
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.69
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.69
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.69
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.69
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.69
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.69
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.69
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.69
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.69
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.69
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.69
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.69
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.69
2div_A99 TRNA selenocysteine associated protein; structural 99.69
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.69
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.69
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.69
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.69
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.69
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.69
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.69
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.69
2div_A99 TRNA selenocysteine associated protein; structural 99.69
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.69
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.69
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.68
2dis_A109 Unnamed protein product; structural genomics, RRM 99.68
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.68
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.68
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.68
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.68
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.68
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.68
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.68
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.68
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.68
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.68
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.67
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.67
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.67
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.67
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.67
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.67
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.67
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.67
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.67
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.67
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.67
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.67
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.66
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.66
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.66
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.66
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.66
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.66
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.66
2dis_A109 Unnamed protein product; structural genomics, RRM 99.66
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.66
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.66
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.66
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.66
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.66
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.65
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.65
1x5p_A97 Negative elongation factor E; structure genomics, 99.65
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.65
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.65
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.65
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.65
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.65
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.65
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.65
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.65
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.65
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.65
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.65
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.65
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.65
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.65
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.65
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.65
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.65
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.65
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.64
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.64
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.64
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.64
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.64
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.64
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.64
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.64
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.64
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.64
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.64
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.64
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.63
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.63
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.63
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.63
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.63
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.63
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.63
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.63
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.63
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.63
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.63
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.63
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.63
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.63
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.63
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.62
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.62
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.62
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.42
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.62
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.62
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.62
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.62
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.62
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.61
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.61
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.61
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.61
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.6
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.6
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.6
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.6
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.6
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.6
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.6
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.59
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.59
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.59
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.58
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.58
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.58
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.58
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.58
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.58
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.58
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.58
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.58
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.57
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.57
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.57
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.57
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.57
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.57
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.57
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.56
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.56
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.56
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.55
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.55
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.55
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.31
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.54
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.54
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.54
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.53
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.53
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.53
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.53
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.53
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.52
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.52
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.51
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.5
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.5
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.49
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.49
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.49
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.49
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.49
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.48
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.48
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.48
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.47
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.47
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.45
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.45
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.45
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.43
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.41
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.4
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.38
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.33
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.32
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.31
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.3
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.29
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.29
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.28
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.27
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.27
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.26
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.24
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.07
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.07
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.06
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.05
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.82
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.66
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.65
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.57
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.53
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.52
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.04
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.02
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.94
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.84
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.68
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.55
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.31
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.3
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.11
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.09
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.03
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.68
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.22
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.02
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.41
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.36
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.93
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 93.54
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 90.52
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 87.05
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-34  Score=224.08  Aligned_cols=155  Identities=21%  Similarity=0.503  Sum_probs=140.1

Q ss_pred             CCCcccEEEcCCCCCCCHHHHHHHhhcCCceEEEEEE--------CCEEEEEeCChHHHHHHHHHhcCCeeCCeeeEEEE
Q psy3721          32 SVGTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVV--------KNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEA  103 (207)
Q Consensus        32 ~~~~~~l~V~~lp~~~t~~~l~~~f~~~g~i~~i~~~--------~~~~fV~f~~~~~a~~a~~~l~~~~~~g~~i~v~~  103 (207)
                      ..+.++|||+|||+++|+++|+++|+.||.|.++.++        +|||||+|.+.++|.+|++.+++..+.|+.|++.+
T Consensus        12 ~~p~~tlfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~~G~afV~F~~~~~A~~Ai~~~~~~~~~g~~i~~~~   91 (213)
T 4f02_A           12 SYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMW   91 (213)
T ss_dssp             ---CCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHHHhhCCEEEEEEecccCCCCccccccceeCCHHHHHHHHHHhhhhhcCCccccccc
Confidence            3567899999999999999999999999999999987        46999999999999999999999999999999999


Q ss_pred             cccCCCC-CCCCceeeecCCCCCCChhHHHHhcccCCcEEEEEEe------cCEEEEEEcc-HhHHHHHHHhCCceeCCe
Q psy3721         104 ATSRKGP-NTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIV------RNYGFVHIDS-PDINKCIKELNGMMVDGK  175 (207)
Q Consensus       104 ~~~~~~~-~~~~~~l~v~nl~~~~t~~~l~~~f~~~g~i~~~~~~------~~~afv~f~~-e~a~~A~~~l~g~~~~g~  175 (207)
                      +...... .....+|||+|||+++++++|+++|+.||.|.+++++      +|||||+|.+ ++|.+|+..|||..++|+
T Consensus        92 ~~~~~~~~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d~~~~~g~~fV~f~~~~~a~~Ai~~lng~~~~g~  171 (213)
T 4f02_A           92 SQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDR  171 (213)
T ss_dssp             CCCCTHHHHHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEEETTEEEEEEEEEESSHHHHHHHHHHHTTCEETTE
T ss_pred             ccccccccccccccceECCcccccHHHHHHHHHhhcCCeEEEEeeccCCCCceEEEEEeCCHHHHHHHHHHhCCCEECCE
Confidence            8754421 2235689999999999999999999999999999986      6899999999 999999999999999999


Q ss_pred             eEEEEeccCcc
Q psy3721         176 PMKVQISTSRV  186 (207)
Q Consensus       176 ~i~v~~~~~~~  186 (207)
                      +|+|.+++++.
T Consensus       172 ~i~V~~a~~~~  182 (213)
T 4f02_A          172 KVFVGRFKSRK  182 (213)
T ss_dssp             ECEEEECCCHH
T ss_pred             EEEEEEcCCCc
Confidence            99999998753



>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-21
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-18
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-17
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-05
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-17
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 7e-14
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 7e-15
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-14
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 9e-14
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-13
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-13
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-13
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-13
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 5e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-13
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-13
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-12
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-13
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-07
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-13
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-11
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-12
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 3e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-12
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-12
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 8e-12
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 5e-12
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-09
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-12
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-11
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 9e-12
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-11
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-11
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-08
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 9e-08
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 4e-10
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 3e-10
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-11
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 9e-11
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 6e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-08
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 7e-09
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-10
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-09
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-07
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-10
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-09
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 4e-10
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-08
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-08
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 5e-10
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 3e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 6e-10
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 6e-09
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-09
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-09
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-09
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-09
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-08
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-09
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-08
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-09
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-09
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-09
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 7e-09
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-09
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 9e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-08
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-08
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 9e-07
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-08
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-08
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-08
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-08
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 5e-04
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 4e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-06
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-08
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 8e-08
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-07
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 8e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 4e-07
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 1e-05
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 5e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-06
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 9e-07
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-04
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 3e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 3e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 7e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 3e-06
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 1e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 8e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 4e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 6e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 4e-05
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 6e-05
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 7e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 8e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.001
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.002
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Heterogeneous nuclear ribonucleoproteins C1/C2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 81.5 bits (201), Expect = 5e-21
 Identities = 19/91 (20%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 103 AATSRKGPNTPTTKVFVGNLS-DNTRAPEVRELFVPYGTVVECDIVRNYGFVHIDSP-DI 160
            ++ +  P +  ++VF+GNL+    +  +V  +F  YG +V C + + + FV   +  + 
Sbjct: 4   GSSGKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNA 63

Query: 161 NKCIKELNGMMVDGKPMKVQISTSRVRQRPG 191
              +   +G M+ G+ + + ++      R G
Sbjct: 64  RAAVAGEDGRMIAGQVLDINLAAEPKVNRSG 94


>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.82
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.8
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.8
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.8
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.79
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.79
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.79
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.78
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.78
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.78
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.78
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.77
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.77
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.77
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.77
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.77
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.77
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.77
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.77
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.77
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.76
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.76
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.76
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.76
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.76
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.76
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.76
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.76
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.76
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.76
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.76
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.76
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.76
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.75
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.75
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.75
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.75
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.75
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.74
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.74
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.74
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.74
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.74
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.74
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.74
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.74
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.73
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.73
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.73
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.73
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.73
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.73
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.73
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.73
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.73
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.73
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.72
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.72
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.72
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.72
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.72
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.72
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.72
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.72
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.72
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.72
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.72
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.72
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.71
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.71
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.71
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.71
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.71
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.71
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.7
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.7
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.7
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.7
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.7
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.7
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.7
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.7
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.7
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.7
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.69
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.69
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.69
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.69
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.68
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.68
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.68
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.68
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.67
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.67
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.67
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.67
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.67
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.67
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.66
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.66
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.65
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.65
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.65
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.65
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.64
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.64
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.64
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.59
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.59
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.57
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.54
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.54
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.52
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.51
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.5
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.48
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.47
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.47
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.45
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.41
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.4
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.39
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.37
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.37
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.36
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.33
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.21
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.88
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.73
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.53
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.48
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.46
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.36
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.36
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.48
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.4e-29  Score=190.89  Aligned_cols=151  Identities=27%  Similarity=0.505  Sum_probs=133.2

Q ss_pred             CcccEEEcCCCCCCCHHHHHHHhhcCCceEEEEEE--------CCEEEEEeCChHHHHHHHHHhcCCeeCCeeeEEEEcc
Q psy3721          34 GTFKIFIGNVNPGTSVELIRPLFEKYGKVVECDVV--------KNYGFVHMENDEEGRTAIKELNGQIVNEKPLKIEAAT  105 (207)
Q Consensus        34 ~~~~l~V~~lp~~~t~~~l~~~f~~~g~i~~i~~~--------~~~~fV~f~~~~~a~~a~~~l~~~~~~g~~i~v~~~~  105 (207)
                      ..++|||+|||+.+|+++|+++|+.||.|.++.+.        +|||||+|.+.++|+.|+. ..+..+.++.+.+.+..
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~   83 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAV   83 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECC
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhh
Confidence            34799999999999999999999999999999886        5799999999999999985 56777888888888775


Q ss_pred             cCCC-----CCCCCceeeecCCCCCCChhHHHHhcccCCcEEEEEEe--------cCEEEEEEcc-HhHHHHHHHhCCce
Q psy3721         106 SRKG-----PNTPTTKVFVGNLSDNTRAPEVRELFVPYGTVVECDIV--------RNYGFVHIDS-PDINKCIKELNGMM  171 (207)
Q Consensus       106 ~~~~-----~~~~~~~l~v~nl~~~~t~~~l~~~f~~~g~i~~~~~~--------~~~afv~f~~-e~a~~A~~~l~g~~  171 (207)
                      ....     ......+|||+|||..+++++|+++|+.||.|..+.+.        +|+|||+|.+ ++|.+|+. +++..
T Consensus        84 ~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~  162 (183)
T d1u1qa_          84 SREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHT  162 (183)
T ss_dssp             CTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEE
T ss_pred             hcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCe
Confidence            4432     33456899999999999999999999999999999886        5699999999 99999986 69999


Q ss_pred             eCCeeEEEEeccCcc
Q psy3721         172 VDGKPMKVQISTSRV  186 (207)
Q Consensus       172 ~~g~~i~v~~~~~~~  186 (207)
                      ++|+.|+|.++.++.
T Consensus       163 ~~G~~i~V~~A~~k~  177 (183)
T d1u1qa_         163 VNGHNCEVRKALSKQ  177 (183)
T ss_dssp             ETTEEEEEEECCCHH
T ss_pred             ECCEEEEEEecCCcc
Confidence            999999999997753



>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure