Diaphorina citri psyllid: psy3738

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MNNKWKNVLFVISSATAEATTTFLLSCLTPSCPFVFPDQDSLKEALLETSPYLLAATVIVSILHSVFELLAFKNDIQFWNNRQSLEGLSVRSVFFNVFQSVVVLLYVLDNDANTLIRISCFVSVGIELWKINKIGT
cccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHccccccc
***KWKNVLFVISSATAEATTTFLLSCLTPSCPFVFPDQDSLKEALLETSPYLLAATVIVSILHSVFELLAFKNDIQFWNNRQSLEGLSVRSVFFNVFQSVVVLLYVLDNDANTLIRISCFVSVGIELWKINKIGT
xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNKWKNVLFVISSATAEATTTFLLSCLTPSCPFVFPDQDSLKEALLETSPYLLAATVIVSILHSVFELLAFKNDIQFWNNRQSLEGLSVRSVFFNVFQSVVVLLYVLDNDANTLIRISCFVSVGIELWKINKIGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cleft lip and palate transmembrane protein 1 homolog May play a role in T-cell development.confidentQ8VBZ3
Cleft lip and palate transmembrane protein 1 homolog May play a role in T-cell development.confidentQ2NL17
Cleft lip and palate transmembrane protein 1 May play a role in T-cell development.confidentO96005

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted