Diaphorina citri psyllid: psy378


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MNVLLHSDNEPYRFRIKFPPDGNRINYVNYDKIDPFADELPKEIEDVWATLCSCWPNNMKVIIRYLIIMSGMAPNQLLNYLSMKVIIRYLIIMSGMAPNQLLNYTDK
ccEEcccccccEEEEEEcccccccccEEEcccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHcEEEEEEEEEccccccccccccc
*******DNEPYRFRIKFPPDGNRINYVNYDKIDPFADELPKEIEDVWATLCSCWPNNMKVIIRYLIIMSGMAPNQLLNYLSMKVIIRYLIIMSGMAPNQL******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVLLHSDNEPYRFRIKFPPDGNRINYVNYDKIDPFADELPKEIEDVWATLCSCWPNNMKVIIRYLIIMSGMAPNQLLNYLSMKVIIRYLIIMSGMAPNQLLNYTDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein furry Trc/fry signaling pathway plays a key role in maintaining the integrity of polarized cell extensions (arista) during morphogenesis, regulates the actin cytoskeleton and plays a key role in patterning sensory neuron dendritic fields by promoting avoidance between homologous dendrites as well as by limiting dendritic branching. Fry positively regulates trc kinase activity.confidentQ9VT28

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0048601 [BP]oocyte morphogenesisprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0009653, GO:0007276, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0016043, GO:0032989, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0007281, GO:0003006, GO:0008150, GO:0022412, GO:0000003, GO:0044767, GO:0044702, GO:0022414, GO:0048856, GO:0044763

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted