Diaphorina citri psyllid: psy3792

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MLDDIFLDELVDDPEPMLNEDHHPEARESQDEDEQPPPNPSEPSEDAVRVAPKKKVIRNPQPKLNAQRLTGPRGIQCIEQYFKDVKFKGKGHELADLNTIMSNLEHWANRLYPKSNFVDVLKRLEVLGHKRPVMTHIKKIRLGMIEELNQDSNLVLSDTETPAQPQQPTSDDIFNDLLASQPSQHITPVVKEITEAQRERMLRNRQIAEEKRLARLAMEAEQKK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MLDDIFLDELVDDPE***********************************************KLNAQRLTGPRGIQCIEQYFKDVKFKGKGHELADLNTIMSNLEHWANRLYPKSNFVDVLKRLEVLGHKRPVMTHIKKIRLGMI*******************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDDIFLDELVDDPEPMLNEDHHPEARESQDEDEQPPPNPSEPSEDAVRVAPKKKVIRNPQPKLNAQRLTGPRGIQCIEQYFKDVKFKGKGHELADLNTIMSNLEHWANRLYPKSNFVDVLKRLEVLGHKRPVMTHIKKIRLGMIEELNQDSNLVLSDTETPAQPQQPTSDDIFNDLLASQPSQHITPVVxxxxxxxxxxxxxxxxxxxxxRLARLAMEAEQKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TIMELESS-interacting protein Required for normal progression of S-phase. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light.confidentQ4QR88
TIMELESS-interacting protein Required for normal progression of S-phase. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light.confidentQ91WA1
TIMELESS-interacting protein Required for normal progression of S-phase. Important for cell survival after DNA damage or replication stress. May be required in the replication checkpoint induced by hydroxyurea or ultraviolet light.confidentQ5F416

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted