Diaphorina citri psyllid: psy3800


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGGE
cccccccHHHHHHcccHHHHHHHHcccccccccEEEcccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccc
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Macro domain-containing protein PA3693 confidentQ9HXU7
O-acetyl-ADP-ribose deacetylase MACROD2 Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins.confidentQ3UYG8
Macro domain-containing protein mll7730 confidentQ985D2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042278 [BP]purine nucleoside metabolic processprobableGO:1901564, GO:0044710, GO:0044238, GO:0055086, GO:0071704, GO:1901135, GO:0009987, GO:0006725, GO:0006139, GO:0044237, GO:1901657, GO:0034641, GO:0006807, GO:0008150, GO:0009116, GO:0008152, GO:0072521, GO:0044281, GO:1901360, GO:0046483
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019213 [MF]deacetylase activityprobableGO:0016787, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X47, chain A
Confidence level:very confident
Coverage over the Query: 1-102
View the alignment between query and template
View the model in PyMOL