Psyllid ID: psy3800


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGGE
cccccccHHHHHHcccHHHHHHHHcccccccccEEEcccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccc
ccHHHHHcHHHHHHccHHHHHHHHHccccccccEEEccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHEcccEEEEcccc
MVWREIIDGAihraagpqlkeecrtlngcetgdakitagynlpaklpinakhvihtvgpvgekpALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGGE
MVWREIidgaihraagpqlkeECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVmkqnnlrsidilkgrqqkwryrlcmtfsrnilirgqmvmyngge
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGGE
**WREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMY****
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGG*
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGGE
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVWREIIDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPALLKSAYQRSLEVMKQNNLRSILEVMKQNNLRSIDILKGRQQKWRYRLCMTFSRNILIRGQMVMYNGGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query133 2.2.26 [Sep-21-2011]
Q3UYG8 475 O-acetyl-ADP-ribose deace yes N/A 0.556 0.155 0.569 9e-20
Q8Q0F9187 Macro domain-containing p yes N/A 0.556 0.395 0.576 4e-19
A1Z1Q3 448 O-acetyl-ADP-ribose deace no N/A 0.556 0.165 0.534 2e-18
Q8TQD0195 Macro domain-containing p yes N/A 0.548 0.374 0.558 2e-18
Q985D2176 Macro domain-containing p yes N/A 0.556 0.420 0.564 3e-18
Q8Y2K1171 Macro domain-containing p yes N/A 0.556 0.432 0.505 3e-17
Q8K4G6258 O-acetyl-ADP-ribose deace no N/A 0.556 0.286 0.523 4e-17
Q9BQ69325 O-acetyl-ADP-ribose deace no N/A 0.556 0.227 0.511 5e-17
Q2KHU5325 O-acetyl-ADP-ribose deace yes N/A 0.548 0.224 0.529 6e-17
Q922B1323 O-acetyl-ADP-ribose deace no N/A 0.556 0.229 0.511 2e-16
>sp|Q3UYG8|MACD2_MOUSE O-acetyl-ADP-ribose deacetylase MACROD2 OS=Mus musculus GN=Macrod2 PE=2 SV=1 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 49/86 (56%), Positives = 59/86 (68%), Gaps = 12/86 (13%)

Query: 7   IDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPV------ 60
           +DG IHRAAGP L  ECR LNGCETG AKIT GY+LP      AK+VIHTVGP+      
Sbjct: 101 VDGCIHRAAGPCLLAECRNLNGCETGHAKITCGYDLP------AKYVIHTVGPIARGHIN 154

Query: 61  GEKPALLKSAYQRSLEVMKQNNLRSI 86
           G     L + YQ SL+++K+NNLRS+
Sbjct: 155 GSHKEDLANCYQSSLKLVKENNLRSV 180




Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: -
>sp|Q8Q0F9|Y177_METMA Macro domain-containing protein MM_0177 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0177 PE=4 SV=1 Back     alignment and function description
>sp|A1Z1Q3|MACD2_HUMAN O-acetyl-ADP-ribose deacetylase MACROD2 OS=Homo sapiens GN=MACROD2 PE=1 SV=1 Back     alignment and function description
>sp|Q8TQD0|Y1614_METAC Macro domain-containing protein MA_1614 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1614 PE=4 SV=1 Back     alignment and function description
>sp|Q985D2|Y7730_RHILO Macro domain-containing protein mll7730 OS=Rhizobium loti (strain MAFF303099) GN=mll7730 PE=4 SV=1 Back     alignment and function description
>sp|Q8Y2K1|Y334_RALSO Macro domain-containing protein RSc0334 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc0334 PE=4 SV=1 Back     alignment and function description
>sp|Q8K4G6|MACD1_RAT O-acetyl-ADP-ribose deacetylase MACROD1 (Fragment) OS=Rattus norvegicus GN=Macrod1 PE=2 SV=2 Back     alignment and function description
>sp|Q9BQ69|MACD1_HUMAN O-acetyl-ADP-ribose deacetylase MACROD1 OS=Homo sapiens GN=MACROD1 PE=1 SV=2 Back     alignment and function description
>sp|Q2KHU5|MACD1_BOVIN O-acetyl-ADP-ribose deacetylase MACROD1 OS=Bos taurus GN=MACROD1 PE=2 SV=1 Back     alignment and function description
>sp|Q922B1|MACD1_MOUSE O-acetyl-ADP-ribose deacetylase MACROD1 OS=Mus musculus GN=Macrod1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
384500015202 hypothetical protein RO3G_15217 [Rhizopu 0.556 0.366 0.65 2e-21
404493680175 O-acetyl-ADP-ribose deacetylase [Pelobac 0.556 0.422 0.619 1e-20
39995633173 O-acetyl-ADP-ribose deacetylase [Geobact 0.548 0.421 0.662 1e-20
307169853228 MACRO domain-containing protein 2 [Campo 0.556 0.324 0.625 3e-20
295425379170 RNase III regulator YmdB [Lactobacillus 0.563 0.441 0.597 4e-20
336370629220 hypothetical protein SERLA73DRAFT_108208 0.556 0.336 0.593 4e-20
164686201182 hypothetical protein CLOBAR_02639 [Clost 0.556 0.406 0.611 5e-20
350419095 271 PREDICTED: MACRO domain-containing prote 0.556 0.273 0.625 6e-20
328791543 270 PREDICTED: MACRO domain-containing prote 0.556 0.274 0.625 6e-20
332029791229 MACRO domain-containing protein 2 [Acrom 0.556 0.323 0.6 7e-20
>gi|384500015|gb|EIE90506.1| hypothetical protein RO3G_15217 [Rhizopus delemar RA 99-880] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 6/80 (7%)

Query: 7   IDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEKPAL 66
           +DGAIHRAAG +L EECRTLNGC  GDAKIT GY LP      AK+VIHTVGP  EKP +
Sbjct: 63  VDGAIHRAAGKELLEECRTLNGCVEGDAKITKGYQLP------AKYVIHTVGPKSEKPDV 116

Query: 67  LKSAYQRSLEVMKQNNLRSI 86
           LKS Y+RSL++M +  L SI
Sbjct: 117 LKSCYERSLQLMDERGLSSI 136




Source: Rhizopus delemar RA 99-880

Species: Rhizopus delemar

Genus: Rhizopus

Family: Rhizopodaceae

Order: Mucorales

Class:

Phylum:

Superkingdom: Eukaryota

>gi|404493680|ref|YP_006717786.1| O-acetyl-ADP-ribose deacetylase [Pelobacter carbinolicus DSM 2380] gi|77545715|gb|ABA89277.1| O-acetyl-ADP-ribose deacetylase [Pelobacter carbinolicus DSM 2380] Back     alignment and taxonomy information
>gi|39995633|ref|NP_951584.1| O-acetyl-ADP-ribose deacetylase [Geobacter sulfurreducens PCA] gi|409911091|ref|YP_006889556.1| O-acetyl-ADP-ribose deacetylase [Geobacter sulfurreducens KN400] gi|39982396|gb|AAR33857.1| O-acetyl-ADP-ribose deacetylase [Geobacter sulfurreducens PCA] gi|298504655|gb|ADI83378.1| O-acetyl-ADP-ribose deacetylase [Geobacter sulfurreducens KN400] Back     alignment and taxonomy information
>gi|307169853|gb|EFN62362.1| MACRO domain-containing protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|295425379|ref|ZP_06818079.1| RNase III regulator YmdB [Lactobacillus amylolyticus DSM 11664] gi|295064931|gb|EFG55839.1| RNase III regulator YmdB [Lactobacillus amylolyticus DSM 11664] Back     alignment and taxonomy information
>gi|336370629|gb|EGN98969.1| hypothetical protein SERLA73DRAFT_108208 [Serpula lacrymans var. lacrymans S7.3] gi|336383408|gb|EGO24557.1| hypothetical protein SERLADRAFT_438166 [Serpula lacrymans var. lacrymans S7.9] Back     alignment and taxonomy information
>gi|164686201|ref|ZP_02210231.1| hypothetical protein CLOBAR_02639 [Clostridium bartlettii DSM 16795] gi|164601803|gb|EDQ95268.1| macro domain protein [Clostridium bartlettii DSM 16795] Back     alignment and taxonomy information
>gi|350419095|ref|XP_003492069.1| PREDICTED: MACRO domain-containing protein 2-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328791543|ref|XP_623181.2| PREDICTED: MACRO domain-containing protein 2-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|332029791|gb|EGI69660.1| MACRO domain-containing protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
UNIPROTKB|Q74FT0173 ymdB "O-acetyl-ADP-ribose deac 0.556 0.427 0.658 2.4e-21
TIGR_CMR|GSU_0526173 GSU_0526 "conserved hypothetic 0.556 0.427 0.658 2.4e-21
MGI|MGI:1920149 475 Macrod2 "MACRO domain containi 0.556 0.155 0.569 3.3e-18
RGD|1591318 531 Macrod2 "MACRO domain containi 0.556 0.139 0.569 4.3e-18
UNIPROTKB|E2RAG4324 MACROD1 "Uncharacterized prote 0.548 0.225 0.564 9.5e-18
UNIPROTKB|A1Z1Q3 448 MACROD2 "O-acetyl-ADP-ribose d 0.556 0.165 0.534 2.7e-17
ZFIN|ZDB-GENE-040426-1490 452 macrod2 "MACRO domain containi 0.556 0.163 0.569 4.5e-17
UNIPROTKB|Q2KHU5325 MACROD1 "O-acetyl-ADP-ribose d 0.548 0.224 0.552 4.9e-17
UNIPROTKB|E7EBY5325 MACROD1 "MACRO domain containi 0.548 0.224 0.552 4.9e-17
ASPGD|ASPL0000035716 374 AN3153 [Emericella nidulans (t 0.556 0.197 0.550 5e-17
UNIPROTKB|Q74FT0 ymdB "O-acetyl-ADP-ribose deacetylase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
 Score = 250 (93.1 bits), Expect = 2.4e-21, P = 2.4e-21
 Identities = 56/85 (65%), Positives = 61/85 (71%)

Query:     7 IDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPV---GEK 63
             +DGAIHRAAGP+L  ECRTLNGC TGDAKITAGY LPAK      HVIHTVGPV   G +
Sbjct:    34 VDGAIHRAAGPELLAECRTLNGCATGDAKITAGYRLPAK------HVIHTVGPVWHGGAR 87

Query:    64 --PALLKSAYQRSLEVMKQNNLRSI 86
               P LL+S Y+RS EV     LRSI
Sbjct:    88 GEPDLLRSCYRRSFEVAHGAGLRSI 112




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|GSU_0526 GSU_0526 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
MGI|MGI:1920149 Macrod2 "MACRO domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1591318 Macrod2 "MACRO domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAG4 MACROD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A1Z1Q3 MACROD2 "O-acetyl-ADP-ribose deacetylase MACROD2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1490 macrod2 "MACRO domain containing 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KHU5 MACROD1 "O-acetyl-ADP-ribose deacetylase MACROD1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7EBY5 MACROD1 "MACRO domain containing protein 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035716 AN3153 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q985D2Y7730_RHILONo assigned EC number0.56470.55630.4204yesN/A
Q8KAE4Y2219_CHLTENo assigned EC number0.53480.54880.4244yesN/A
Q2KHU5MACD1_BOVIN3, ., 5, ., 1, ., -0.52940.54880.2246yesN/A
Q3UYG8MACD2_MOUSE3, ., 5, ., 1, ., -0.56970.55630.1557yesN/A
Q8Q0F9Y177_METMANo assigned EC number0.57640.55630.3957yesN/A
Q8Y2K1Y334_RALSONo assigned EC number0.50580.55630.4327yesN/A
Q9HXU7Y3693_PSEAENo assigned EC number0.52320.54880.4219yesN/A
Q8TQD0Y1614_METACNo assigned EC number0.55810.54880.3743yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
cd02908165 cd02908, Macro_Appr_pase_like, Macro domain, Appr- 4e-41
pfam01661117 pfam01661, Macro, Macro domain 7e-29
PRK00431177 PRK00431, PRK00431, RNase III inhibitor; Provision 3e-28
cd02905140 cd02905, Macro_GDAP2_like, Macro domain, GDAP2_lik 6e-20
PRK04143264 PRK04143, PRK04143, hypothetical protein; Provisio 1e-19
cd02906147 cd02906, Macro_1, Macro domain, Unknown family 1 5e-19
COG2110179 COG2110, COG2110, Predicted phosphatase homologous 8e-17
smart00506133 smart00506, A1pp, Appr-1"-p processing enzyme 1e-14
cd02749147 cd02749, Macro, Macro domain, a high-affinity ADP- 2e-12
cd02907175 cd02907, Macro_Af1521_BAL_like, Macro domain, Af15 5e-12
cd02903137 cd02903, Macro_BAL_like, Macro domain, BAL_like fa 1e-08
cd03330133 cd03330, Macro_2, Macro domain, Unknown family 2 1e-05
>gnl|CDD|239236 cd02908, Macro_Appr_pase_like, Macro domain, Appr-1"-pase_like family Back     alignment and domain information
 Score =  133 bits (338), Expect = 4e-41
 Identities = 50/85 (58%), Positives = 60/85 (70%), Gaps = 11/85 (12%)

Query: 7   IDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGE---- 62
           +DGAIHRAAGP+L EECR L GC TG+A IT+GYNLP      AK+VIHTVGPV      
Sbjct: 31  VDGAIHRAAGPELLEECRELRGCPTGEAVITSGYNLP------AKYVIHTVGPVWRGGQH 84

Query: 63  -KPALLKSAYQRSLEVMKQNNLRSI 86
            +  LL S Y+ SLE+ ++N LRSI
Sbjct: 85  NEAELLASCYRNSLELARENGLRSI 109


The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. This family is composed of uncharacterized proteins that show similarity to Appr-1"-pase, containing conserved putative active site residues. Appr-1"-pase is a phosphatase specific for ADP-ribose-1"-monophosphate. Length = 165

>gnl|CDD|216634 pfam01661, Macro, Macro domain Back     alignment and domain information
>gnl|CDD|234759 PRK00431, PRK00431, RNase III inhibitor; Provisional Back     alignment and domain information
>gnl|CDD|239233 cd02905, Macro_GDAP2_like, Macro domain, GDAP2_like family Back     alignment and domain information
>gnl|CDD|235225 PRK04143, PRK04143, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239234 cd02906, Macro_1, Macro domain, Unknown family 1 Back     alignment and domain information
>gnl|CDD|225021 COG2110, COG2110, Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|214701 smart00506, A1pp, Appr-1"-p processing enzyme Back     alignment and domain information
>gnl|CDD|239150 cd02749, Macro, Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) Back     alignment and domain information
>gnl|CDD|239235 cd02907, Macro_Af1521_BAL_like, Macro domain, Af1521- and BAL-like family Back     alignment and domain information
>gnl|CDD|239231 cd02903, Macro_BAL_like, Macro domain, BAL_like family Back     alignment and domain information
>gnl|CDD|239446 cd03330, Macro_2, Macro domain, Unknown family 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
cd02904186 Macro_H2A_like Macro domain, Macro_H2A_like family 100.0
cd02905140 Macro_GDAP2_like Macro domain, GDAP2_like family. 100.0
PRK04143264 hypothetical protein; Provisional 99.97
cd02906147 Macro_1 Macro domain, Unknown family 1. The macro 99.97
cd02908165 Macro_Appr_pase_like Macro domain, Appr-1"-pase_li 99.97
cd02903137 Macro_BAL_like Macro domain, BAL_like family. The 99.96
PRK00431177 RNase III inhibitor; Provisional 99.96
cd02907175 Macro_Af1521_BAL_like Macro domain, Af1521- and BA 99.96
COG2110179 Predicted phosphatase homologous to the C-terminal 99.94
cd03330133 Macro_2 Macro domain, Unknown family 2. The macro 99.94
PF01661118 Macro: Macro domain; InterPro: IPR002589 The Macro 99.94
KOG2633|consensus200 99.9
cd02900186 Macro_Appr_pase Macro domain, Appr-1"-pase family. 99.88
smart00506133 A1pp Appr-1"-p processing enzyme. Function determi 99.87
cd02749147 Macro Macro domain, a high-affinity ADP-ribose bin 99.86
PRK13341725 recombination factor protein RarA/unknown domain f 99.83
cd02901140 Macro_Poa1p_like Macro domain, Poa1p_like family. 99.65
PHA02595154 tk.4 hypothetical protein; Provisional 99.38
PF14519280 Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJ 97.54
cd03331152 Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like fam 97.45
PF10154510 DUF2362: Uncharacterized conserved protein (DUF236 96.1
TIGR02452266 conserved hypothetical protein TIGR02452. Members 87.68
>cd02904 Macro_H2A_like Macro domain, Macro_H2A_like family Back     alignment and domain information
Probab=100.00  E-value=9.2e-34  Score=219.02  Aligned_cols=94  Identities=20%  Similarity=0.268  Sum_probs=88.7

Q ss_pred             CcccchHHHHHHHhhCHHHHHHHHhh----CCCCCCcEEEccCCCCCCCCCCCCceEEEeeCCCC---CcHHHHHHHHHH
Q psy3800           1 MVWREIIDGAIHRAAGPQLKEECRTL----NGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVG---EKPALLKSAYQR   73 (133)
Q Consensus         1 ~~~~ggVs~AI~~aaG~~l~~ec~~~----~~~~~G~~viT~~~~L~~~~~~~~k~IIH~VgP~~---~~~~~L~~~y~~   73 (133)
                      |..+|||++||+++||++|++||+++    +++++|++++|++|+|||      |||||+|||.|   +++++|++||++
T Consensus        45 L~~ggGV~~AI~~aaG~~l~~ec~~~~~~~g~~~~G~~~iT~a~~Lp~------k~VIHtVgP~~~~~~~~~~L~~~~~~  118 (186)
T cd02904          45 IDLKGEVGNALEKKGGKEFVEAVKELRKSNGPLEIAGAAVSQAHGLPA------KFVIHCHSPQWGSDKCEEQLEKTVKN  118 (186)
T ss_pred             cCCCCcHhHHHHHHcCHHHHHHHHHHHHhcCCCCCCCEEEccCCCCCC------CEEEEeCCCCCCCCchHHHHHHHHHH
Confidence            45789999999999999999999765    789999999999999999      99999999999   567899999999


Q ss_pred             HHHHHHHCCCcEEEEccccccccchHH
Q psy3800          74 SLEVMKQNNLRSILEVMKQNNLRSIDI  100 (133)
Q Consensus        74 ~L~~A~~~~~~SIAfPaigtG~~g~~~  100 (133)
                      ||++|++++++|||||+||||++|||.
T Consensus       119 ~L~~A~e~~~~SIAfPaIstG~~g~P~  145 (186)
T cd02904         119 CLAAAEDKKLKSIAFPSLPSGRNGFPK  145 (186)
T ss_pred             HHHHHHHcCCCEEEECCcccCCCCCCH
Confidence            999999999999999999999999983



The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. Members of this family are similar to macroH2A, a variant of the major-type core histone H2A, which contains an N-terminal H2A domain and a C-terminal nonhistone macro domain. Histone macroH2A is enriched on the inactive X chromosome of mammalian female cells. It does not bind poly ADP-r

>cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family Back     alignment and domain information
>PRK04143 hypothetical protein; Provisional Back     alignment and domain information
>cd02906 Macro_1 Macro domain, Unknown family 1 Back     alignment and domain information
>cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family Back     alignment and domain information
>cd02903 Macro_BAL_like Macro domain, BAL_like family Back     alignment and domain information
>PRK00431 RNase III inhibitor; Provisional Back     alignment and domain information
>cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family Back     alignment and domain information
>COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] Back     alignment and domain information
>cd03330 Macro_2 Macro domain, Unknown family 2 Back     alignment and domain information
>PF01661 Macro: Macro domain; InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands Back     alignment and domain information
>KOG2633|consensus Back     alignment and domain information
>cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family Back     alignment and domain information
>smart00506 A1pp Appr-1"-p processing enzyme Back     alignment and domain information
>cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family Back     alignment and domain information
>PHA02595 tk Back     alignment and domain information
>PF14519 Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJR_A Back     alignment and domain information
>cd03331 Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like family, SNF2 subfamily Back     alignment and domain information
>PF10154 DUF2362: Uncharacterized conserved protein (DUF2362); InterPro: IPR019311 This is a family of proteins conserved from nematodes to humans Back     alignment and domain information
>TIGR02452 conserved hypothetical protein TIGR02452 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2x47_A235 Crystal Structure Of Human Macrod1 Length = 235 4e-18
1spv_A184 Crystal Structure Of The Putative Phosphatase Of Es 4e-10
4ess_A167 Crystal Structure Of E6dL155R VARIANT OF DE NOVO DE 6e-05
3v45_A167 Crystal Structure Of De Novo Designed Serine Hydrol 6e-05
2dx6_A159 Crystal Structure Of Conserved Hypothetical Protein 7e-05
4etj_A167 Crystal Structure Of E6h Variant Of De Novo Designe 7e-05
4gvv_A167 Crystal Structure Of De Novo Design Serine Hydrolas 7e-05
4etk_A167 Crystal Structure Of E6aL130DA155H VARIANT OF DE NO 8e-05
>pdb|2X47|A Chain A, Crystal Structure Of Human Macrod1 Length = 235 Back     alignment and structure

Iteration: 1

Score = 86.7 bits (213), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 44/86 (51%), Positives = 57/86 (66%), Gaps = 12/86 (13%) Query: 7 IDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPV------ 60 +DG IHRAAGP L +ECRTL C+TG AKIT GY LP AK+VIHTVGP+ Sbjct: 93 VDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLP------AKYVIHTVGPIAYGEPS 146 Query: 61 GEKPALLKSAYQRSLEVMKQNNLRSI 86 + A L+S Y SL+++ ++ LRS+ Sbjct: 147 ASQAAELRSCYLSSLDLLLEHRLRSV 172
>pdb|1SPV|A Chain A, Crystal Structure Of The Putative Phosphatase Of Escherichia Coli, Northeast Structural Genomoics Target Er58 Length = 184 Back     alignment and structure
>pdb|4ESS|A Chain A, Crystal Structure Of E6dL155R VARIANT OF DE NOVO DESIGNED SERINE Hydrolase Osh55, Northeast Structural Genomics Consortium (Nesg) Target Or187 Length = 167 Back     alignment and structure
>pdb|3V45|A Chain A, Crystal Structure Of De Novo Designed Serine Hydrolase Osh55, Northeast Structural Genomics Consortium Target Or130 Length = 167 Back     alignment and structure
>pdb|2DX6|A Chain A, Crystal Structure Of Conserved Hypothetical Protein, Ttha0132 From Thermus Thermophilus Hb8 Length = 159 Back     alignment and structure
>pdb|4ETJ|A Chain A, Crystal Structure Of E6h Variant Of De Novo Designed Serine Hydrolase Osh55, Northeast Structural Genomics Consortium (Nesg) Target Or185 Length = 167 Back     alignment and structure
>pdb|4GVV|A Chain A, Crystal Structure Of De Novo Design Serine Hydrolase Osh55.27, Northeast Structural Genomics Consortium (Nesg) Target Or246 Length = 167 Back     alignment and structure
>pdb|4ETK|A Chain A, Crystal Structure Of E6aL130DA155H VARIANT OF DE NOVO DESIGNED Serine Hydrolase, Northeast Structural Genomics Consortium (Nesg) Target Or186 Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2dx6_A159 Hypothetical protein TTHA0132; conserved hypotheti 3e-41
2x47_A235 Macro domain-containing protein 1; signaling prote 4e-41
2xd7_A193 Core histone macro-H2A.2; chromosomal protein, nuc 9e-40
1yd9_A193 Core histone macro-H2A.1; alpha-beta structure, A1 2e-39
3q6z_A214 Poly [ADP-ribose] polymerase 14; structural genomi 4e-39
1spv_A184 Putative polyprotein/phosphatase; structural genom 1e-38
3q71_A221 Poly [ADP-ribose] polymerase 14; structural genomi 3e-38
1vhu_A211 Hypothetical protein AF1521; structural genomics, 1e-36
3kh6_A199 Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 6e-35
3ejf_A176 Non-structural protein 3; IBV, coronavirus, X-doma 1e-32
2acf_A182 Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 2e-32
3gpg_A168 NSP3, non-structural protein 3; macro domain, X do 3e-32
3gqe_A168 Non-structural protein 3; macro domain, X domain, 4e-30
2vri_A174 Non-structural protein 3; RNA replication, nucleot 2e-29
3eti_A168 X (ADRP) domain, macro domain of non-structural pr 7e-29
3ejg_A193 Non-structural protein 3; HCOV 229E, X-domain, mac 8e-27
1njr_A284 32.1 kDa protein in ADH3-RCA1 intergenic region; s 8e-08
>2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A Length = 159 Back     alignment and structure
 Score =  133 bits (338), Expect = 3e-41
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 7   IDGAIHRAAGPQLKEECRTLNGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVGEK--P 64
           + GAI R  GP ++EEC  +     G+A +T   NLP       ++VIH      E    
Sbjct: 33  VAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLP------VRYVIHAAVLGDEPASL 86

Query: 65  ALLKSAYQRSLEVMKQNNLRSI 86
             ++ A + +LE   +  L+++
Sbjct: 87  ETVRKATKSALEKAVELGLKTV 108


>2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} Length = 235 Back     alignment and structure
>2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} Length = 193 Back     alignment and structure
>1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A Length = 193 Back     alignment and structure
>3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} Length = 214 Back     alignment and structure
>1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 Length = 184 Back     alignment and structure
>3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* Length = 211 Back     alignment and structure
>3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* Length = 176 Back     alignment and structure
>2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* Length = 182 Back     alignment and structure
>3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A Length = 168 Back     alignment and structure
>3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* Length = 168 Back     alignment and structure
>2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} Length = 174 Back     alignment and structure
>3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* Length = 168 Back     alignment and structure
>3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* Length = 193 Back     alignment and structure
>1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* Length = 284 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
1spv_A184 Putative polyprotein/phosphatase; structural genom 99.97
2xd7_A193 Core histone macro-H2A.2; chromosomal protein, nuc 99.97
3q6z_A214 Poly [ADP-ribose] polymerase 14; structural genomi 99.97
1yd9_A193 Core histone macro-H2A.1; alpha-beta structure, A1 99.97
3q71_A221 Poly [ADP-ribose] polymerase 14; structural genomi 99.97
2x47_A235 Macro domain-containing protein 1; signaling prote 99.97
4abl_A183 Poly [ADP-ribose] polymerase 14; transferase, PARP 99.97
2dx6_A159 Hypothetical protein TTHA0132; conserved hypotheti 99.97
3kh6_A199 Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 99.96
3eti_A168 X (ADRP) domain, macro domain of non-structural pr 99.96
1vhu_A211 Hypothetical protein AF1521; structural genomics, 99.96
3ejf_A176 Non-structural protein 3; IBV, coronavirus, X-doma 99.95
3gpg_A168 NSP3, non-structural protein 3; macro domain, X do 99.95
3gqe_A168 Non-structural protein 3; macro domain, X domain, 99.94
2acf_A182 Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 99.94
3ejg_A193 Non-structural protein 3; HCOV 229E, X-domain, mac 99.93
1njr_A284 32.1 kDa protein in ADH3-RCA1 intergenic region; s 99.93
2vri_A174 Non-structural protein 3; RNA replication, nucleot 99.92
4gua_A 670 Non-structural polyprotein; viral precursor polypr 99.91
2eee_A149 Uncharacterized protein C6ORF130; macro domain, A1 99.85
2jyc_A160 Uncharacterized protein C6ORF130; macro domain, A1 99.84
2fg1_A158 Conserved hypothetical protein BT1257; structural 99.81
3sig_A277 PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1 97.78
>1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 Back     alignment and structure
Probab=99.97  E-value=1e-31  Score=205.09  Aligned_cols=95  Identities=39%  Similarity=0.563  Sum_probs=89.5

Q ss_pred             CcccchHHHHHHHhhCHHHHHHHHhh----CCCCCCcEEEccCCCCCCCCCCCCceEEEeeCCCC-----CcHHHHHHHH
Q psy3800           1 MVWREIIDGAIHRAAGPQLKEECRTL----NGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVG-----EKPALLKSAY   71 (133)
Q Consensus         1 ~~~~ggVs~AI~~aaG~~l~~ec~~~----~~~~~G~~viT~~~~L~~~~~~~~k~IIH~VgP~~-----~~~~~L~~~y   71 (133)
                      +..+|||++||++++||+|++||+++    +++++|++++|++|+||+      |||||+|||.|     .+.+.|++||
T Consensus        28 l~~ggGv~~aI~~aaG~~l~~e~~~~~~~~g~~~~G~a~iT~~~~L~~------k~VIH~vgP~~~~~~~~~~~~L~~~y  101 (184)
T 1spv_A           28 LMGGGGVDGAIHRAAGPALLDACLKVRQQQGDCPTGHAVITLAGDLPA------KAVVHTVGPVWRGGEQNEDQLLQDAY  101 (184)
T ss_dssp             CSCCSHHHHHHHHHHCHHHHHHHHHHHHHHCSCCTTCEEEECCTTSSS------SEEEEECCCCCSSSSSSHHHHHHHHH
T ss_pred             CCCCchHHHHHHHHhCHHHHHHHHHHHHhcCCCCCCCEEEeeCCCCCC------CEEEEEcCCcccCCCcchHHHHHHHH
Confidence            45789999999999999999999987    899999999999999999      99999999999     3578999999


Q ss_pred             HHHHHHHHHCCCcEEEEccccccccchHHH
Q psy3800          72 QRSLEVMKQNNLRSILEVMKQNNLRSIDIL  101 (133)
Q Consensus        72 ~~~L~~A~~~~~~SIAfPaigtG~~g~~~~  101 (133)
                      +++|++|++++++|||||+||||++|+|..
T Consensus       102 ~~~L~~a~~~~~~SIAfP~IstG~~g~p~~  131 (184)
T 1spv_A          102 LNSLRLVAANSYTSVAFPAISTGVYGYPRA  131 (184)
T ss_dssp             HHHHHHHHHTTCSEEEECCTTSSTTCCCHH
T ss_pred             HHHHHHHHHhCCceEEeccccCCCCCCCHH
Confidence            999999999999999999999999999843



>2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} Back     alignment and structure
>3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} Back     alignment and structure
>1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A Back     alignment and structure
>3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} Back     alignment and structure
>2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} Back     alignment and structure
>4abl_A Poly [ADP-ribose] polymerase 14; transferase, PARP14; 1.15A {Homo sapiens} PDB: 4abk_A Back     alignment and structure
>2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A Back     alignment and structure
>3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* Back     alignment and structure
>1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* Back     alignment and structure
>3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* Back     alignment and structure
>3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A Back     alignment and structure
>3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* Back     alignment and structure
>2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* Back     alignment and structure
>3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* Back     alignment and structure
>1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* Back     alignment and structure
>2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>2eee_A Uncharacterized protein C6ORF130; macro domain, A1PP domain, ADP-ribose binding, rossmann fold, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l8r_A* Back     alignment and structure
>2fg1_A Conserved hypothetical protein BT1257; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.25A {Bacteroides thetaiotaomicron} SCOP: c.50.1.2 PDB: 2afc_A Back     alignment and structure
>3sig_A PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1.28A {Thermomonospora curvata} PDB: 3sih_A 3sii_A* 3sij_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 133
d1yd9a1188 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Ratt 1e-11
d1vhua_192 c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeo 8e-11
d1njra_264 c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker' 3e-10
d1spva_172 c.50.1.2 (A:) Hypothetical protein YmbD {Escherich 2e-09
d2acfa1168 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SA 2e-09
d2fg1a1154 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Ba 5e-05
>d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 188 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Macro domain-like
superfamily: Macro domain-like
family: Macro domain
domain: Histone macro-H2a1.1
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 57.0 bits (137), Expect = 1e-11
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 13/87 (14%)

Query: 7   IDGAIHRAAGPQLKEECRTL----NGCETGDAKITAGYNLPAKLPINAKHVIHTVGPV-- 60
           +   + +  G +  E    L       E   A ++AG+ LP      AK VIH   PV  
Sbjct: 45  VGSTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLP------AKFVIHCNSPVWG 98

Query: 61  -GEKPALLKSAYQRSLEVMKQNNLRSI 86
             +   LL+   +  L +     L+SI
Sbjct: 99  SDKCEELLEKTVKNCLALADDRKLKSI 125


>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 192 Back     information, alignment and structure
>d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 264 Back     information, alignment and structure
>d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} Length = 172 Back     information, alignment and structure
>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} Length = 168 Back     information, alignment and structure
>d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d1yd9a1188 Histone macro-H2a1.1 {Rat (Rattus norvegicus) [Tax 99.96
d1spva_172 Hypothetical protein YmbD {Escherichia coli [TaxId 99.96
d1vhua_192 Hypothetical protein AF1521 {Archaeon Archaeoglobu 99.93
d2acfa1168 Replicase polyprotein 1ab {SARS coronavirus [TaxId 99.9
d1njra_264 Hypothetical protein Ymr087W {Baker's yeast (Sacch 99.79
d2fg1a1154 Hypothetical protein BT1257 {Bacteroides thetaiota 99.66
>d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Macro domain-like
superfamily: Macro domain-like
family: Macro domain
domain: Histone macro-H2a1.1
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.96  E-value=4.8e-29  Score=187.93  Aligned_cols=95  Identities=23%  Similarity=0.285  Sum_probs=88.7

Q ss_pred             cccchHHHHHHHhhCHHHHHHHHhh----CCCCCCcEEEccCCCCCCCCCCCCceEEEeeCCCC---CcHHHHHHHHHHH
Q psy3800           2 VWREIIDGAIHRAAGPQLKEECRTL----NGCETGDAKITAGYNLPAKLPINAKHVIHTVGPVG---EKPALLKSAYQRS   74 (133)
Q Consensus         2 ~~~ggVs~AI~~aaG~~l~~ec~~~----~~~~~G~~viT~~~~L~~~~~~~~k~IIH~VgP~~---~~~~~L~~~y~~~   74 (133)
                      .++||+++||++++|++|++||+++    +++++|++++|++|+|||      +||||+|+|.|   .+.+.|++||+++
T Consensus        40 ~~~~gv~~ai~~~~G~~l~~e~~~~~~~~~~~~~g~~~vT~~~~L~~------k~IiH~v~P~~~~~~~~~~L~~~~~~~  113 (188)
T d1yd9a1          40 YIGGEVGSTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPA------KFVIHCNSPVWGSDKCEELLEKTVKNC  113 (188)
T ss_dssp             CCCSHHHHHHHHHHHHHHHHHHHHHHHHHCSCCTTCEEEEECTTSSS------SEEEEECCCCTTSTTHHHHHHHHHHHH
T ss_pred             CCCchHHHHHHHHHHHHHHHHHHHHHHhccccCCCCeeecccCCCCc------eEEeeeccccCCCcchHHHHHHHHHHH
Confidence            4689999999999999999999754    889999999999999999      99999999999   6778999999999


Q ss_pred             HHHHHHCCCcEEEEccccccccchHHHh
Q psy3800          75 LEVMKQNNLRSILEVMKQNNLRSIDILK  102 (133)
Q Consensus        75 L~~A~~~~~~SIAfPaigtG~~g~~~~~  102 (133)
                      |+.|++++++|||||+||||.+|+|...
T Consensus       114 L~~a~~~~~~SIafP~igtG~~g~p~~~  141 (188)
T d1yd9a1         114 LALADDRKLKSIAFPSIGSGRNGFPKQT  141 (188)
T ss_dssp             HHHHHHTTCSEEEECCCSBSTTCBCHHH
T ss_pred             HHHHHHcCCCeEEeccccCCCCCCCHHH
Confidence            9999999999999999999999998433



>d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} Back     information, alignment and structure
>d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure