Diaphorina citri psyllid: psy3805


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MELVFDPDLSDGEEAAALVKELILILQCLGTSTCKMQEGALRVDANVSVQRRTDTKLGTRSEVKNIGSIRGVANAVNFEIVRQVALLEQGGVVVNETRAYDAATKRTVSMRDKENIQVKPRSHFKTLSLSLTLLNLLCI
cccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccccccHHccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccEEccccccccccccccccccccccHHHHHHHcc
MELVFDPDLSDGEEAAALVKELILILQCLGTSTCKMQEGALRVDANVSVQRRTDTKLGTRSEVKNIGSIRGVANAVNFEIVRQVALLEQGGVVVNETRAYDAATKRTVSMRDKENIQVKPRSHFKTLSLSLTLLNLLCI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELVFDPDLSDGEEAAALVKELILILQCLGTSTCKMQEGALRVDANVSVQRRTDTKLGTRSEVKNIGSIRGVANAVNFEIVRQVALLEQGGVVVNETRAYDAATKRTVSMRDKENIQVKPRSHFKTLSLSLTLLNLLCI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).confidentQ98ND3
Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).confidentQ9VCD0
Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).confidentA9VWZ8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030956 [CC]glutamyl-tRNA(Gln) amidotransferase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0070681 [BP]glutaminyl-tRNAGln biosynthesis via transamidationprobableGO:0019752, GO:0090304, GO:0034641, GO:0006807, GO:0044281, GO:0034660, GO:1901360, GO:0006139, GO:0044710, GO:0044260, GO:0006520, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0016070, GO:0044238, GO:1901564, GO:0006082, GO:0044237, GO:0043170, GO:0006399, GO:0043038, GO:0043039
GO:0050567 [MF]glutaminyl-tRNA synthase (glutamine-hydrolyzing) activityprobableGO:0016879, GO:0003674, GO:0016874, GO:0016884, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AL0, chain B
Confidence level:very confident
Coverage over the Query: 1-137
View the alignment between query and template
View the model in PyMOL