Diaphorina citri psyllid: psy3819


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MPGYDRCTYPILPNRSEEDCECPRVGLGECPLVVYLPYFTKQVRRGLRVSQGGTGCTYPILPNRSEEDCECPRVGLGECPLVTSAIITDDGIGINPQQTAGTVFMKHGCELRLIPRDRVGSR
cccccccccccccccccccccccccccccccEEEEcccccHHccccCEEccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEECcccccccCCccccccc
****DRCTYPILPNRSEEDCECPRVGLGECPLVVYLPYFTKQVRRGLRVSQGGTGCTYPILPNRSEEDCECPRVGLGECPLVTSAIITDDGIGINPQQTAGTVFMKHGCELRLIPRD*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGYDRCTYPILPNRSEEDCECPRVGLGECPLVVYLPYFTKQVRRGLRVSQGGTGCTYPILPNRSEEDCECPRVGLGECPLVTSAIITDDGIGINPQQTAGTVFMKHGCELRLIPRDRVGSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-fold modifier 1 Ubiquitin-like modifier protein which binds to a number of as yet unidentified target proteins.confidentB5E0K3
Ubiquitin-fold modifier 1 Ubiquitin-like modifier protein which binds to a number of target proteins, such as DDRGK1.confidentP61960
Ubiquitin-fold modifier 1 Ubiquitin-like modifier protein which binds to a number of target proteins, such as DDRGK1.confidentQ5R4N5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071569 [BP]protein ufmylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J0G, chain A
Confidence level:very confident
Coverage over the Query: 75-121
View the alignment between query and template
View the model in PyMOL