Diaphorina citri psyllid: psy3823


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MVNLIFNSTDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKTNTEVTSLMNKHIQ
cCEEEEEcccccCEEccccEEEEEEccccEEEEEEEEECccccEEEEEEcccccccccccCEECccccEEEEEEEEccccccEEEEEEEECcccccccCEEEEEECcccccccccccEEEEEcccccccccccccccEEEEEEEECcccccEEEEEEccEEcccccccEEEEEccEEEEccccccccCEEEEEEECcccccccccEEEEEEEEEEEEcccccccCECccccEEEEEEccccEEEEEEEECcccccEEEEEEccccccccccccEEECcccEEEEEEEEccccccEEEEEEEECccCEEEEEEEEEEEEccccccccEEEEccccEEEECcccccccCEEEEccEEcccccccccc
MVNLIFNSTDEPVC***QQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTA***LTSYSI****TSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSD****************SVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKT*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNLIFNSTDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKTNTEVTSLMNKHIQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 6-211,222-320
View the alignment between query and template
View the model in PyMOL
Template: 2Y23, chain A
Confidence level:very confident
Coverage over the Query: 18-316
View the alignment between query and template
View the model in PyMOL
Template: 2JLL, chain A
Confidence level:very confident
Coverage over the Query: 20-211,222-354
View the alignment between query and template
View the model in PyMOL