Psyllid ID: psy3823


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MVNLIFNSTDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKTNTEVTSLMNKHIQ
cEEEEEEcccccEEEccccEEEEEEccccEEEEEEEEEEccccEEEEEEcccccccccccEEEEccccEEEEEEEEccccccEEEEEEEEEcccccccEEEEEEEEcccccccccccEEEEEcccccccccccccccEEEEEEEEEcccccEEEEEEccEEcccccccEEEEEccEEEEccccccccEEEEEEEEEcccccccccEEEEEEEEEEEEcccccccEEEccccEEEEEEccccEEEEEEEEEcccccEEEEEEccccccccccccEEEEcccEEEEEEEEccccccEEEEEEEEEccEEEEEEEEEEEEEccccccccEEEEccccEEEEEcccccccEEEEEccEEcccccccccc
ccEEEEEccccccEEccccEEEEEEcccEEEEEEEEcccccccEEEEEEccEEEccccccccEcccccEEEEEEEEcccccccEEEEEEEccccccccccEEEEEccccccccccccEEEEEEcccccccEEEcccEEEEEEEEcccccccEEEEEEccEEEcccccEEEEEcccEEEEEEEEcccccEEEEEEEccccccccccEEEEEEEccccccccccccccccccccEEEEEcccEEEEEEEEEccccccEEEEEEcccEEccccccEEEEccccEEEEEEEEcccccccEEEEEEEcccccccccEEEEEEEccccccccccccEEEEEEEEcccccccccEEEEcccccEEEcccccc
mvnlifnstdepvckqsQQRIYGALRNEQVLVSCtvdanpqaqyftwafnnsgtaprpltsysiqdgstsvarytptseleyGTLLCWArneqgnqrtpctfhvvkagecehpvdkpsvqiklgrnlnasvlnegvdiyfdchiqanppykkliwthngitisnnasagriiTNQTLVLQSvtrhsgglyacsainsqgeggstpfdlnINKMVNLIFNsidepvckqsQQRIYGALRNEQVLVSCtvdanpqaqyftwafnnsdtaprpltsysiqdgstsvarytptseleyGTLLCWArneqgsqrtpctfhvvkagecehpvAVSHRYVAKLYAtnakgagpmvLMKTNTEVTSLMNKHIQ
mvnlifnstdepvckQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYAtnakgagpmvLMKTNTEVTslmnkhiq
MVNLIFNSTDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKTNTEVTSLMNKHIQ
*************C***QQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTA***LTSYSI****TSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSD****************SVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLM***************
MVNLIFNSTDEPVC************NEQVLVSCTVDANPQAQYFTWAFNNS****************TSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNAS**RIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFN*******************SVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKT*************
MVNLIFNSTDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKTNTEVTSLMNKHIQ
MVNLIFNSTDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKTNTEVTSLMN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNLIFNSTDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHPVAVSHRYVAKLYATNAKGAGPMVLMKTNTEVTSLMNKHIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
Q8NFP4 955 MAM domain-containing gly yes N/A 0.745 0.284 0.246 1e-08
O01761 8081 Muscle M-line assembly pr no N/A 0.789 0.035 0.248 4e-08
Q0PMG2 940 MAM domain-containing gly yes N/A 0.745 0.289 0.243 4e-08
P85171 956 MAM domain-containing gly yes N/A 0.745 0.284 0.243 7e-08
Q0WYX8 949 MAM domain-containing gly yes N/A 0.630 0.242 0.238 1e-07
P11464419 Pregnancy-specific beta-1 no N/A 0.556 0.484 0.287 1e-06
Q9UQ74426 Pregnancy-specific beta-1 no N/A 0.539 0.462 0.290 2e-06
Q967D7 1531 Protein turtle OS=Drosoph no N/A 0.676 0.161 0.227 3e-06
Q8NDA2 5065 Hemicentin-2 OS=Homo sapi no N/A 0.706 0.050 0.215 3e-06
Q13046419 Putative pregnancy-specif no N/A 0.547 0.477 0.276 5e-06
>sp|Q8NFP4|MDGA1_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Homo sapiens GN=MDGA1 PE=1 SV=1 Back     alignment and function desciption
 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 118/308 (38%), Gaps = 36/308 (11%)

Query: 10  DEPV--CKQSQQRIYGALRNEQ-VLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQD 66
           DEP+    Q+   + G    E+ V + CTV++NP A+ F W   +   +        I +
Sbjct: 130 DEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPAR-FIWKRGSDTLSHSQDNGVDIYE 188

Query: 67  -----GSTSVARYTPTSELEYGTLLCWA--RNEQGNQRTPCTFHVVKAGECEHPVDKPSV 119
                G T V +       +Y +  C    RN  G      TF +            P++
Sbjct: 189 PLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNT------TAPPAL 242

Query: 120 QIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVL 179
           ++ +   L   V+N G ++   C +    P  +L W+H           G +    TL +
Sbjct: 243 KLSVNETL---VVNPGENVTVQCLLTGGDPLPQLQWSHG----PGPLPLGALAQGGTLSI 295

Query: 180 QSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRN 239
            SV     G Y C+A N+ G       +L +  M N  F  I   V K+S+    G    
Sbjct: 296 PSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQ-ITPDVIKESENIQLG---- 350

Query: 240 EQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSEL------E 293
           + + +SC VDA PQ +     F N   A R      +      +   T + EL      +
Sbjct: 351 QDLKLSCHVDAVPQEKVTYQWFKNGKPA-RMSKRLLVTRNDPELPAVTSSLELIDLHFSD 409

Query: 294 YGTLLCWA 301
           YGT LC A
Sbjct: 410 YGTYLCMA 417




Required for radial migration of cortical neurons in the superficial layer of the neocortex.
Homo sapiens (taxid: 9606)
>sp|O01761|UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans GN=unc-89 PE=1 SV=3 Back     alignment and function description
>sp|Q0PMG2|MDGA1_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Mus musculus GN=Mdga1 PE=2 SV=2 Back     alignment and function description
>sp|P85171|MDGA1_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Rattus norvegicus GN=Mdga1 PE=2 SV=1 Back     alignment and function description
>sp|Q0WYX8|MDGA1_CHICK MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Gallus gallus GN=MDGA1 PE=1 SV=1 Back     alignment and function description
>sp|P11464|PSG1_HUMAN Pregnancy-specific beta-1-glycoprotein 1 OS=Homo sapiens GN=PSG1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UQ74|PSG8_HUMAN Pregnancy-specific beta-1-glycoprotein 8 OS=Homo sapiens GN=PSG8 PE=2 SV=2 Back     alignment and function description
>sp|Q967D7|TUTL_DROME Protein turtle OS=Drosophila melanogaster GN=tutl PE=2 SV=2 Back     alignment and function description
>sp|Q8NDA2|HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2 Back     alignment and function description
>sp|Q13046|PSG7_HUMAN Putative pregnancy-specific beta-1-glycoprotein 7 OS=Homo sapiens GN=PSG7 PE=5 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
242021433 647 Fasciclin-2 precursor, putative [Pedicul 0.545 0.307 0.492 6e-53
242010771 853 sidestep protein, putative [Pediculus hu 0.531 0.227 0.455 5e-49
345495896 923 PREDICTED: nephrin-like [Nasonia vitripe 0.547 0.216 0.457 3e-48
347966676 1016 AGAP001824-PA [Anopheles gambiae str. PE 0.758 0.272 0.356 3e-48
307198721 976 Nephrin [Harpegnathos saltator] 0.547 0.204 0.442 7e-48
21356009 939 CG12950, isoform A [Drosophila melanogas 0.594 0.231 0.432 9e-48
195330304 939 GM26222 [Drosophila sechellia] gi|194120 0.594 0.231 0.432 1e-47
224586972 631 RT01989p [Drosophila melanogaster] 0.654 0.378 0.406 1e-47
195572176 939 GD20766 [Drosophila simulans] gi|1941999 0.594 0.231 0.432 1e-47
157116252458 sidestep protein [Aedes aegypti] gi|1088 0.660 0.526 0.375 1e-47
>gi|242021433|ref|XP_002431149.1| Fasciclin-2 precursor, putative [Pediculus humanus corporis] gi|212516398|gb|EEB18411.1| Fasciclin-2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  214 bits (544), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 134/209 (64%), Gaps = 10/209 (4%)

Query: 117 PSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQT 176
           P V + LG N+N S + EGVD+YF+C + ANP  + + W H G  ++NNA+AG II NQT
Sbjct: 329 PQVTLTLGSNINGSSIREGVDVYFECSVTANPWIRLVTWQHGGKNLTNNATAGTIIANQT 388

Query: 177 LVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGA 236
           LVLQSV+R++ G+Y CSA NS+G   S  F L++            EP C+  QQRIYGA
Sbjct: 389 LVLQSVSRYNTGIYTCSASNSEGSAESNSFLLDVKY----------EPQCRPGQQRIYGA 438

Query: 237 LRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGT 296
            RNE V V+C VD+NP A  F W FNNS    + +   +I+ G  SVA Y+PT+E  YGT
Sbjct: 439 ARNEMVTVTCEVDSNPSASLFRWTFNNSVVKSKDVDFRTIEQGGKSVATYSPTNEQGYGT 498

Query: 297 LLCWARNEQGSQRTPCTFHVVKAGECEHP 325
           LLCW RNE G Q  PC +H+V AG+ + P
Sbjct: 499 LLCWGRNELGPQVVPCVYHIVPAGKPDPP 527




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242010771|ref|XP_002426132.1| sidestep protein, putative [Pediculus humanus corporis] gi|212510179|gb|EEB13394.1| sidestep protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345495896|ref|XP_001601559.2| PREDICTED: nephrin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|347966676|ref|XP_321229.5| AGAP001824-PA [Anopheles gambiae str. PEST] gi|333469949|gb|EAA01423.6| AGAP001824-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307198721|gb|EFN79530.1| Nephrin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|21356009|ref|NP_649933.1| CG12950, isoform A [Drosophila melanogaster] gi|442618306|ref|NP_001262432.1| CG12950, isoform B [Drosophila melanogaster] gi|17861610|gb|AAL39282.1| GH14967p [Drosophila melanogaster] gi|23170839|gb|AAF54434.2| CG12950, isoform A [Drosophila melanogaster] gi|220947102|gb|ACL86094.1| CG12950-PA [synthetic construct] gi|440217266|gb|AGB95814.1| CG12950, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195330304|ref|XP_002031844.1| GM26222 [Drosophila sechellia] gi|194120787|gb|EDW42830.1| GM26222 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|224586972|gb|ACN58585.1| RT01989p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195572176|ref|XP_002104072.1| GD20766 [Drosophila simulans] gi|194199999|gb|EDX13575.1| GD20766 [Drosophila simulans] Back     alignment and taxonomy information
>gi|157116252|ref|XP_001658403.1| sidestep protein [Aedes aegypti] gi|108883456|gb|EAT47681.1| AAEL001227-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
FB|FBgn0259213 1064 CG42313 [Drosophila melanogast 0.747 0.256 0.373 9.9e-42
FB|FBgn0086604 1201 CG12484 [Drosophila melanogast 0.778 0.236 0.356 8.5e-40
FB|FBgn0016061 939 side "sidestep" [Drosophila me 0.542 0.210 0.310 3.3e-21
UNIPROTKB|F1PGE1 954 MDGA1 "Uncharacterized protein 0.742 0.284 0.258 1.6e-10
UNIPROTKB|F1RVR8 935 MDGA1 "Uncharacterized protein 0.742 0.289 0.258 2e-10
UNIPROTKB|Q8NFP4 955 MDGA1 "MAM domain-containing g 0.742 0.283 0.255 2.7e-10
UNIPROTKB|J3KNB7 959 MDGA1 "MAM domain-containing g 0.742 0.282 0.255 2.7e-10
MGI|MGI:1922012 940 Mdga1 "MAM domain containing g 0.742 0.288 0.252 5.6e-10
UNIPROTKB|F1MHX8 955 MDGA1 "Uncharacterized protein 0.742 0.283 0.255 7.5e-10
UNIPROTKB|D4AC96 941 Mdga1 "MAM domain-containing g 0.742 0.287 0.252 9.4e-10
FB|FBgn0259213 CG42313 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 453 (164.5 bits), Expect = 9.9e-42, P = 9.9e-42
 Identities = 114/305 (37%), Positives = 161/305 (52%)

Query:    32 VSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGST-SVARYTPTSELEYGTLLCWAR 90
             VSC    +      TW     G      T   I   ST S   + PT++ +  ++ C A 
Sbjct:   290 VSCESSGSRPNAIITWY---KGKRQLRRTKDDISKNSTRSELSFVPTTDDDGKSITCRAE 346

Query:    91 NEQGNQ---RTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQAN 147
             N   N     T    +VV      +P   P V ++LG  L    + EG D+YF+CH+Q+N
Sbjct:   347 NPNVNGLYLETMWKLNVV------YP---PLVTLRLGSTLTPDDIKEGDDVYFECHVQSN 397

Query:   148 PPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFD 207
             P ++KL+W HNGI + +N SA  I +NQ+LVLQ +T+H  G YACSAIN +GE  S    
Sbjct:   398 PQWRKLLWLHNGIHLEHNTSARVIRSNQSLVLQKITKHYAGNYACSAINDEGETVSNQLP 457

Query:   208 LNINKMVNLIFNSIDEPVCKQSQQRIY-GALRNEQVLVSCTVDANPQAQYFTWAFNNS-D 265
             L +             P+CK + + I  GA ++E V V C + A+P  + F W FNNS +
Sbjct:   458 LRVKYT----------PMCKHADRVILIGASKDETVEVVCEIQADPPPRTFRWKFNNSGE 507

Query:   266 TAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGECEHP 325
             T       +S+ +GS S+ +YTP ++ +YGTL CWA NE G+Q+ PC F VV A     P
Sbjct:   508 TLDVGSERFSV-NGSRSILKYTPVTDQDYGTLSCWASNEVGTQQHPCLFQVVLAAL---P 563

Query:   326 VAVSH 330
              AVS+
Sbjct:   564 NAVSN 568


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
FB|FBgn0086604 CG12484 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0016061 side "sidestep" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGE1 MDGA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVR8 MDGA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFP4 MDGA1 "MAM domain-containing glycosylphosphatidylinositol anchor protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNB7 MDGA1 "MAM domain-containing glycosylphosphatidylinositol anchor protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1922012 Mdga1 "MAM domain containing glycosylphosphatidylinositol anchor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHX8 MDGA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D4AC96 Mdga1 "MAM domain-containing glycosylphosphatidylinositol anchor protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 7e-07
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 5e-05
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 1e-04
cd0009674 cd00096, Ig, Immunoglobulin domain 6e-04
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 0.001
smart0041085 smart00410, IG_like, Immunoglobulin like 0.004
smart0040985 smart00409, IG, Immunoglobulin 0.004
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
 Score = 46.3 bits (110), Expect = 7e-07
 Identities = 21/84 (25%), Positives = 34/84 (40%), Gaps = 9/84 (10%)

Query: 127 LNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHS 186
            + +V+ EG D+   C    NPP     W  +G+ +S++ +             +V+   
Sbjct: 6   PSPTVVFEGEDVTLTCSAPGNPPPN-YTWYKDGVPLSSSQNG--------FFTPNVSAED 56

Query: 187 GGLYACSAINSQGEGGSTPFDLNI 210
            G Y C A N  G   S P  L +
Sbjct: 57  SGTYTCVASNGGGGKTSNPVTLTV 80


This domain contains immunoglobulin-like domains. Length = 80

>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
KOG3513|consensus 1051 100.0
KOG3513|consensus 1051 100.0
KOG4221|consensus 1381 99.98
KOG4194|consensus873 99.96
PHA02785326 IL-beta-binding protein; Provisional 99.96
KOG4222|consensus 1281 99.94
KOG4221|consensus 1381 99.93
KOG4222|consensus 1281 99.92
PHA02826227 IL-1 receptor-like protein; Provisional 99.83
KOG4194|consensus873 99.82
PHA02826227 IL-1 receptor-like protein; Provisional 99.78
PHA02785326 IL-beta-binding protein; Provisional 99.74
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.58
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.57
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.56
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.53
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.52
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.51
KOG3515|consensus 741 99.51
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.51
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.5
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.49
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.49
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.49
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.49
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.48
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.48
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.47
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.47
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.47
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.47
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.46
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.45
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.45
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.45
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.44
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.44
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.44
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.44
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.43
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.43
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.43
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.43
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.42
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.42
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.42
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.42
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.42
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.42
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.42
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.42
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.42
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.42
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.42
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.41
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.41
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.41
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.41
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.4
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.4
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.4
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.4
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.39
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.39
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.39
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.39
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.38
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.38
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.38
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.38
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.38
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.37
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.37
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.37
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.37
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.37
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.37
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.37
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.37
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.37
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.37
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.37
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.36
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.36
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.36
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.36
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.36
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.35
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.35
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.35
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.35
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.34
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.34
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.33
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.33
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.33
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.33
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.33
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.32
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.32
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.32
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.32
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.32
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.31
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.31
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.31
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.31
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.3
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.3
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.3
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.29
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.29
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.29
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.29
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.29
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.29
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.28
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.28
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.28
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.27
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.27
KOG3515|consensus 741 99.27
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.27
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.27
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.27
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.26
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.26
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.26
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.26
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.26
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.26
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.26
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.26
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.26
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.26
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.25
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.25
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.25
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.25
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.25
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.24
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.24
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.24
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.24
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.24
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.23
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.23
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.23
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.22
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.22
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.22
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.22
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.21
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.21
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.21
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.2
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.2
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.2
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.19
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.19
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.19
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.18
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.18
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.18
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.17
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.17
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.17
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.16
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.16
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.16
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.15
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.15
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.14
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.14
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.14
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.14
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 99.13
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.12
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.12
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.12
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.12
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 99.08
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.08
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 99.08
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.07
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.06
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.04
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.03
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.03
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 98.99
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.99
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.98
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.98
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 98.97
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.97
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 98.96
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 98.96
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.96
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.95
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.94
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.93
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.92
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.92
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.92
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.9
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.89
smart0040986 IG Immunoglobulin. 98.89
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.88
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.87
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.85
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.85
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.84
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.83
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.82
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.81
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.81
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.78
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.77
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.76
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.74
smart0040986 IG Immunoglobulin. 98.74
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.72
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.7
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.67
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.67
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.67
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.65
PHA03376221 BARF1; Provisional 98.64
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.63
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.6
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.59
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.58
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.57
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.57
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.56
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.55
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.54
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.54
PHA03376221 BARF1; Provisional 98.52
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.47
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.46
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.45
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.44
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.42
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.42
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.42
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.41
PHA03270466 envelope glycoprotein C; Provisional 98.4
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.39
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 98.39
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.39
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.38
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.38
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.38
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.38
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.37
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.36
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.36
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.35
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.35
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.35
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.34
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.33
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.32
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.31
PHA02987189 Ig domain OX-2-like protein; Provisional 98.31
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.29
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.29
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.28
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.27
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.23
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.22
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.22
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 98.21
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.21
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.21
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.19
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.17
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.17
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 98.17
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.17
PHA03269566 envelope glycoprotein C; Provisional 98.16
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 98.15
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.15
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.14
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 98.13
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.13
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.12
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.12
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.11
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.11
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 98.1
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 98.1
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.08
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 98.06
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 98.06
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.05
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.04
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 98.03
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.03
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.99
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.98
PHA02987189 Ig domain OX-2-like protein; Provisional 97.97
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.96
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.96
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.94
PHA03271490 envelope glycoprotein C; Provisional 97.93
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.93
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.92
PHA03273486 envelope glycoprotein C; Provisional 97.91
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.89
smart0040775 IGc1 Immunoglobulin C-Type. 97.88
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.87
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.85
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.84
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.83
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.82
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.82
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 97.8
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.79
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 97.78
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.77
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.74
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.74
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 97.72
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.72
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.71
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.71
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 97.69
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 97.69
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 97.68
cd0577093 IgC_beta2m Class I major histocompatibility comple 97.67
cd0577093 IgC_beta2m Class I major histocompatibility comple 97.67
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.66
smart0040775 IGc1 Immunoglobulin C-Type. 97.62
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.58
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 97.58
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.58
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 97.54
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.53
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.52
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 97.5
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.5
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 97.48
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.47
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 97.45
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 97.44
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 97.42
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 97.41
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.39
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 97.37
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 97.36
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.28
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 97.27
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.27
smart0040681 IGv Immunoglobulin V-Type. 97.21
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 97.16
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 97.16
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 97.14
KOG1480|consensus 909 97.14
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.12
smart0040681 IGv Immunoglobulin V-Type. 97.12
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.02
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 96.96
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 96.92
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 96.88
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 96.88
PHA03269566 envelope glycoprotein C; Provisional 96.8
PHA0263363 hypothetical protein; Provisional 96.8
PHA02982251 hypothetical protein; Provisional 96.78
PHA02982251 hypothetical protein; Provisional 96.76
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 96.72
KOG0613|consensus 1205 96.68
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 96.62
PHA02914 500 Immunoglobulin-like domain protein; Provisional 96.43
PHA03270466 envelope glycoprotein C; Provisional 96.39
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 96.38
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 96.37
PHA0263363 hypothetical protein; Provisional 96.3
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 96.27
KOG1480|consensus 909 96.05
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 95.95
PHA03271490 envelope glycoprotein C; Provisional 95.89
PHA03273 486 envelope glycoprotein C; Provisional 95.87
PHA03042286 CD47-like protein; Provisional 95.62
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 95.46
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 95.24
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 95.04
PF07354 271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 94.98
PHA03042 286 CD47-like protein; Provisional 94.16
PHA02914500 Immunoglobulin-like domain protein; Provisional 94.11
PF02124211 Marek_A: Marek's disease glycoprotein A; InterPro: 94.07
KOG4597|consensus560 93.5
PHA02865338 MHC-like TNF binding protein; Provisional 92.54
KOG4597|consensus 560 92.34
cd0589098 Ig2_Nectin-1_like Second immunoglobulin (Ig) domai 92.09
PHA02865338 MHC-like TNF binding protein; Provisional 90.77
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 90.45
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 90.42
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 90.35
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 90.11
KOG0613|consensus 1205 88.6
PF02124211 Marek_A: Marek's disease glycoprotein A; InterPro: 87.92
PHA03283 542 envelope glycoprotein E; Provisional 87.49
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 85.12
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 84.25
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 84.16
PHA03112141 IL-18 binding protein; Provisional 84.05
PF02480 439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 83.09
PHA03286 492 envelope glycoprotein E; Provisional 82.54
PHA03283 542 envelope glycoprotein E; Provisional 81.02
PHA03282 540 envelope glycoprotein E; Provisional 80.56
>KOG3513|consensus Back     alignment and domain information
Probab=100.00  E-value=7.3e-39  Score=304.55  Aligned_cols=280  Identities=20%  Similarity=0.308  Sum_probs=235.2

Q ss_pred             cccCCeEeeCCceEEEEecCCcEEEEEEeCCCCCcceEEEEeCCCcCCCCCCceeEecCCeEEEEEEccCCCCCCeEEEE
Q psy3823           8 STDEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLC   87 (365)
Q Consensus         8 ~~~~p~~~~~~~~~~~v~~G~~~~l~C~~~~~p~~~~v~W~~~~~~~l~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C   87 (365)
                      -.|+|.+....+.......|+.+.|.|.+.|+|.| ++.|+|.+.. .............   +|.|.+++.+|+|.|+|
T Consensus       237 ~~~~P~i~~~~p~~~~a~~G~~v~LECfA~G~P~P-~i~W~k~~g~-~~~~r~~~~~~~~---vL~I~nv~~~D~G~Y~C  311 (1051)
T KOG3513|consen  237 REYAPKILVPFPETETALKGQSVKLECFALGNPTP-QIKWRKVDGK-PPPRRATYSNYGK---VLKIPNVQYEDAGEYEC  311 (1051)
T ss_pred             cccCCccccCCCCcccccCCCeEEEEEEecCCCCC-cEEEEeCCCC-CCCcceeeecccc---EEEecccCcCCCeEEEE
Confidence            56788887777767778999999999999999999 9999999885 3322222222233   89999999999999999


Q ss_pred             EEEeCCCCCcccEEEEEEeccccCCCCCCCeEEEEcCCccCccceecCCcEEEEEEEEecCCCCeeEEEeCCeEEeeCCC
Q psy3823          88 WARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNAS  167 (365)
Q Consensus        88 ~a~~~~~~~~~~~~l~V~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~g~~v~l~C~~~~~p~~~~i~W~~~~~~l~~~~~  167 (365)
                      .|.|..|.....+.|+|         ..+|.....+    .+..+..|++++|.|.+.|.|.|. ++|++||.++.....
T Consensus       312 ~AeN~~G~~~~~~~v~v---------~a~P~w~~~~----~d~~~~~gs~v~~eC~a~g~P~p~-v~WlkNg~pl~~~~r  377 (1051)
T KOG3513|consen  312 IAENSRGSATHSGHVTV---------YAPPYWLQKP----QDTEADTGSNVTLECKASGKPNPT-VKWLKNGEPLEPAER  377 (1051)
T ss_pred             EEecccccceeeEEEEE---------ecCchhhccc----ceeEecCCCCeEEEEEecCCCCCc-eEEeeCCeecCccCC
Confidence            99999997779999999         7788755543    455788899999999999999999 999999999985443


Q ss_pred             -CceEEeeceEEEeeecCCCCeEEEEEEEcCCCCCCcccEEEEEeeeeecccccCCCCceecCc-cceeeeecCceEEEE
Q psy3823         168 -AGRIITNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQ-QRIYGALRNEQVLVS  245 (365)
Q Consensus       168 -~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~s~~~~l~v~~~~~~~~~~~~~p~~~~~~-~~~~~~~~g~~~~l~  245 (365)
                       .+....+++|.|.+++..|+|.|+|.|.|..|... ..+.|+|+.         .+|.+...+ ...+.+..|..+.|.
T Consensus       378 ~~~~~i~~g~L~is~v~~~dsg~YQC~A~Nk~G~i~-anA~L~V~a---------~~P~f~~~p~~~~~~a~~g~~v~i~  447 (1051)
T KOG3513|consen  378 DPRYKIDDGTLIISNVQESDSGVYQCIAENKYGTIY-ANAELKVLA---------SAPVFPLNPVERKVMAVVGGTVTID  447 (1051)
T ss_pred             CcceEEeCCEEEEEecccccCeEEEeeeecccceEe-eeeEEEEEc---------cCCCCCCCccceEEEEEeCCeEEEe
Confidence             34667789999999999999999999999999887 678999984         457766544 444558899999999


Q ss_pred             EEEeeeCCCceeEEEeCCCCCCCCCCceeEeeCCCEEEEEEcCCCcccCeEEEEEEEcCCccceecEEEEEEcCcc
Q psy3823         246 CTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVVKAGE  321 (365)
Q Consensus       246 C~~~~~p~~~~~~W~~~~~~~~~~~~~~~~~~~~~~s~l~i~~v~~~d~G~Y~C~a~n~~g~~~~~~~l~v~~~~~  321 (365)
                      |...+.|.|. +.|.+.+. ...+..+..+..+|+   |.|.+++.+|+|.|+|.|.|..|.+.....|.|..+++
T Consensus       448 C~~~asP~p~-~~W~k~~~-~~~~~~r~~i~edGt---L~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~Vkd~tr  518 (1051)
T KOG3513|consen  448 CKPFASPKPK-VSWLKGGE-KLLQSGRIRILEDGT---LEISNVTRSDAGKYTCVAENKLGKAESTGNLIVKDATR  518 (1051)
T ss_pred             eccCCCCcce-EEEEcCCc-ccccCceEEECCCCc---EEecccCcccCcEEEEEEEcccCccceEEEEEEecCce
Confidence            9999999998 99999887 556666777778886   99999999999999999999999999999998876665



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] Back     alignment and domain information
>PHA03283 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PHA03112 IL-18 binding protein; Provisional Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>PHA03286 envelope glycoprotein E; Provisional Back     alignment and domain information
>PHA03283 envelope glycoprotein E; Provisional Back     alignment and domain information
>PHA03282 envelope glycoprotein E; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
1bih_A395 Crystal Structure Of The Insect Immune Protein Hemo 5e-04
>pdb|1BIH|A Chain A, Crystal Structure Of The Insect Immune Protein Hemolin: A New Domain Arrangement With Implications For Homophilic Adhesion Length = 395 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 42/174 (24%), Positives = 68/174 (39%), Gaps = 23/174 (13%) Query: 31 LVSCTVDANPQA--QYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYT-PTSELEYGTLLC 87 ++ C +NP YF + +G +T ++ G + + T P E G C Sbjct: 231 MIYCMYGSNPMGYPNYFKNGKDVNGNPEDRITRHNRTSGKRLLFKTTLPEDE---GVYTC 287 Query: 88 WARNEQGN-QRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQA 146 N G Q+ VV A + E KP I V+ +G D+ C + Sbjct: 288 EVDNGVGKPQKHSLKLTVVSAPKYEQ---KPEKVI---------VVKQGQDVTIPCKVTG 335 Query: 147 NPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACSAINSQGE 200 P ++W+HN +S + +T+ LV++ V G Y C A N G+ Sbjct: 336 LPA-PNVVWSHNAKPLSGGRAT---VTDSGLVIKGVKNGDKGYYGCRATNEHGD 385

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 4e-23
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 5e-11
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-08
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 1e-22
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 3e-18
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 3e-16
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 7e-16
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 4e-14
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-22
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-19
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-16
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-15
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-14
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-13
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-07
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-05
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 6e-22
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-19
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-16
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-16
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 3e-19
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-14
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 6e-12
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 9e-19
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-18
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 6e-18
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-15
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-12
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-18
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 2e-18
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-17
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-15
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-10
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-17
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-12
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-17
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-11
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 1e-16
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 7e-13
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-16
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 8e-11
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-10
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-16
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 4e-16
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-14
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 3e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-07
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 5e-16
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 5e-13
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 6e-16
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-16
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 2e-13
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-15
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-07
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 5e-15
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-14
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-12
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 2e-14
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 3e-14
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 3e-14
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 5e-07
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 7e-14
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 7e-10
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-13
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-10
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-13
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 2e-13
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 3e-10
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 4e-13
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-09
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 5e-13
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 5e-09
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 7e-13
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-12
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-08
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 4e-07
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 8e-13
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 1e-07
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-12
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-12
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 1e-12
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 2e-12
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-12
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 6e-11
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-12
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-12
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-09
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-12
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-11
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 2e-12
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 7e-10
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-12
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 5e-12
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 1e-09
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 3e-12
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 6e-12
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 8e-12
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-11
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-11
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-09
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 1e-11
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 2e-09
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-11
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-10
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 6e-11
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-07
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 7e-11
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 9e-11
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 9e-11
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 1e-08
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 1e-10
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-10
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-09
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-10
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 1e-06
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-10
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 6e-08
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-10
3mjg_X289 Beta-type platelet-derived growth factor receptor; 5e-10
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-08
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 3e-10
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 4e-08
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 4e-10
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 9e-06
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 5e-10
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 2e-08
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 8e-10
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-09
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 1e-09
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 4e-08
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-09
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-09
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-09
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 7e-09
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-09
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 1e-07
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 4e-09
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 4e-09
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 5e-09
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-08
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 6e-09
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 6e-09
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 9e-09
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 1e-08
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-08
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 2e-08
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 5e-07
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 2e-08
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 2e-08
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 3e-08
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 4e-08
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 3e-04
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 5e-08
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 5e-08
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 1e-05
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 6e-05
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 5e-08
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 5e-08
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 7e-08
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 1e-04
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 7e-08
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 1e-07
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 1e-04
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-07
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-07
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-07
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-07
1wwb_X103 Protein (brain derived neurotrophic factor recepto 3e-07
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 5e-07
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 5e-07
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 6e-07
2ens_A96 Advanced glycosylation END product-specific recept 7e-07
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 7e-07
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 8e-07
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 7e-04
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 2e-06
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-06
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 3e-06
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 3e-06
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-06
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 3e-06
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 3e-06
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 3e-06
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 5e-06
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 1e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 1e-05
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 1e-05
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
1gl4_B98 Basement membrane-specific heparan sulfate proteog 2e-05
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 3e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-05
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 4e-05
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 5e-05
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 6e-05
2v9t_A117 Roundabout homolog 1; structural protein-receptor 7e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-04
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-04
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 1e-04
3s35_X122 Vascular endothelial growth factor receptor 2; ant 2e-04
1he7_A126 High affinity nerve growth factor receptor; transf 3e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 3e-04
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 4e-04
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 5e-04
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 5e-04
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 5e-04
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 6e-04
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
 Score = 99.4 bits (247), Expect = 4e-23
 Identities = 56/316 (17%), Positives = 92/316 (29%), Gaps = 53/316 (16%)

Query: 24  ALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARY-----TPTS 78
               E+  V+CT+     + Y TW   N           S   G  +  R      +   
Sbjct: 223 LREGEEFTVTCTIKDVSSSVYSTWKREN-SQTKLQEKYNSWHHGDFNYERQATLTISSAR 281

Query: 79  ELEYGTLLCWARNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDI 138
             + G  +C+A N  G+     T  VV         DK  + I    N    V N+G ++
Sbjct: 282 VNDSGVFMCYANNTFGSANVTTTLEVV---------DKGFINIFPMINTTVFV-NDGENV 331

Query: 139 YFDCHIQANPPYKKLIWTHNGITISNNA-------SAGRIITNQTLVLQSVTRHSGGLYA 191
                 +A P  +   W +   T ++         +   I     L L  +    GG Y 
Sbjct: 332 DLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYT 391

Query: 192 CSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCTVDAN 251
               NS                 N+  N+  +P        I    R    ++ C     
Sbjct: 392 FLVSNSDVN---------AAIAFNVYVNT--KP-------EILTYDRLVNGMLQCVAAGF 433

Query: 252 PQAQYFTWAFN-----NSDTAPRPLTSYSIQDGSTSVARYTPTSELE------YGTLLCW 300
           P+     W F          +  P+   ++        +    S ++       GT+ C 
Sbjct: 434 PEPT-IDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECK 492

Query: 301 ARNEQGSQRTPCTFHV 316
           A N+ G       F  
Sbjct: 493 AYNDVGKTSAYFNFAF 508


>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 100.0
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 100.0
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 100.0
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 100.0
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 100.0
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 100.0
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 100.0
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 100.0
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 100.0
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 100.0
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 100.0
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 100.0
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 100.0
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 100.0
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 100.0
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 100.0
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 100.0
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 100.0
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 100.0
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 100.0
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 100.0
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 100.0
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.98
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.98
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.98
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.98
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.98
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.98
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.97
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.97
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.97
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.97
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.97
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.97
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.97
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.97
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.97
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.97
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.97
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.97
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 99.97
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.97
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.97
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.97
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.97
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.96
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.96
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.96
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.96
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.96
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.96
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.95
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.95
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.94
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 99.94
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.94
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.94
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 99.94
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.93
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.93
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.93
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.93
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.93
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.92
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.92
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.92
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.92
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.92
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.92
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.92
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.92
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.92
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.92
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.92
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.91
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.91
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.91
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.91
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.91
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.91
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.91
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.91
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.91
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.91
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.9
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.9
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.9
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.9
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.9
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.9
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.9
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.9
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.9
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.9
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.9
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.9
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.89
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.89
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.89
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.89
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.89
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.89
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.89
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.88
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.88
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.88
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.88
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.88
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.88
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.88
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.88
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.88
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.88
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.88
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.88
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.88
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.88
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.88
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.88
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.88
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.88
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.88
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.88
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.87
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.87
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.87
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.87
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.87
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.87
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.87
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.87
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.87
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.87
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.87
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.87
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.86
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.86
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.86
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.86
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.86
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.86
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.86
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.86
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.86
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.85
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.85
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.85
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.85
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.85
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.85
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.85
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.85
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.85
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.85
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.85
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.85
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.85
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.85
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.84
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.84
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.84
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.84
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.84
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.84
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.84
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.84
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.84
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.83
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.83
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.83
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.83
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.83
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.83
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.83
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.83
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.83
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.82
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.82
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.82
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.82
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.82
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.82
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.82
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.82
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.82
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.82
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.81
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.81
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.81
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.81
3sob_L237 Antibody light chain; beta propeller, protein bind 99.81
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.81
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.81
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.81
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.81
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.81
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.81
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.81
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.8
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.8
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.8
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.79
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.79
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.79
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.79
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.79
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.79
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.79
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.79
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.79
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.79
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.79
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.78
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.78
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.78
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.78
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.78
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.78
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.77
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.77
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.77
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.77
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.77
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.77
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.77
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.77
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.77
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.77
3umt_A256 SCFV heavy chain and light chain; stability engine 99.77
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.77
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.76
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.76
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.76
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.76
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.76
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.76
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.76
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.76
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.76
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.76
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.76
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.76
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.76
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.76
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.76
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.75
3sob_L237 Antibody light chain; beta propeller, protein bind 99.75
3umt_A256 SCFV heavy chain and light chain; stability engine 99.75
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.75
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.75
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.75
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.75
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.75
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.75
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.75
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.75
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.75
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.75
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.75
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.74
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.74
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.74
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.74
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.74
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.74
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.74
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.74
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.74
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.74
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.74
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.74
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.73
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.73
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.73
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.73
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.73
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.73
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.73
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.73
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.73
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.73
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.73
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.73
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.73
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.73
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.73
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.72
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.72
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.72
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.72
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.72
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.72
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.72
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.72
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.72
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.72
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.72
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.72
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.71
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.71
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.71
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.71
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.71
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.71
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.71
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.71
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.7
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.7
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.7
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.7
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.7
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.7
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 99.7
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.7
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.7
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.7
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.69
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.69
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.69
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.69
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.69
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.69
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.69
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.69
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.68
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.68
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.67
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.67
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.67
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.67
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.66
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.66
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.66
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.66
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.66
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.66
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.66
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.66
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.66
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.65
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.65
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.65
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.65
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.65
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.65
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.65
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.64
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.64
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.64
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.64
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.64
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.64
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.63
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.63
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.63
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.63
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.63
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.62
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.62
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.62
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.61
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.61
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.6
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.6
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.6
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.59
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.59
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.59
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.59
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.58
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.57
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.57
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.57
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.55
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.54
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.54
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.54
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 99.54
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 99.53
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.53
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.53
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.52
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 99.52
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 99.52
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.52
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.51
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.51
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 99.5
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.49
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.49
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.48
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.48
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.48
3iu4_H263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 99.48
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.47
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 99.47
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 99.47
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 99.46
3mlr_H226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 99.46
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.46
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 99.46
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.44
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.44
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.44
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.43
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.43
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.43
1hxm_A229 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.43
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.43
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.43
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.43
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.43
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.43
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.42
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.42
3iu4_H263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 99.42
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.42
3f8u_B401 Tapasin; endoplasmic reticulum, glycoprotein, immu 99.41
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.41
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.41
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.41
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.41
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.41
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.4
3mlr_H226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 99.4
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.4
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.4
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.4
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.39
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 99.39
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 99.39
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.38
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.38
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.38
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.38
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.37
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.37
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.37
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.36
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.36
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.36
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.36
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.35
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.35
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.35
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.34
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 99.34
3u1s_H267 FAB PGT145 heavy chain; IGG, broadly neutralizing 99.34
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.34
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.34
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.34
1he7_A126 High affinity nerve growth factor receptor; transf 99.34
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.34
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.33
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.33
3f8u_B401 Tapasin; endoplasmic reticulum, glycoprotein, immu 99.32
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.32
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.32
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.31
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.31
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.31
1he7_A126 High affinity nerve growth factor receptor; transf 99.3
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.3
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.3
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.3
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.29
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.29
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.28
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.28
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.28
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.28
3s35_X122 Vascular endothelial growth factor receptor 2; ant 99.28
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.28
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.27
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.27
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.27
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.26
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 99.26
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.26
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.26
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.26
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.25
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.25
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.25
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.25
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.24
1gl4_B98 Basement membrane-specific heparan sulfate proteog 99.24
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.24
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.24
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.23
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.23
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.23
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.22
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
Probab=100.00  E-value=2.9e-37  Score=270.01  Aligned_cols=278  Identities=17%  Similarity=0.297  Sum_probs=219.3

Q ss_pred             cCCeEeeCCceEEEEecCCcEEEEEEeCCCCCcceEEEEeCCCcCCCCCCceeEecCCeEEEEEEccCCCCCCeEEEEEE
Q psy3823          10 DEPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSGTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWA   89 (365)
Q Consensus        10 ~~p~~~~~~~~~~~v~~G~~~~l~C~~~~~p~~~~v~W~~~~~~~l~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~a   89 (365)
                      .+|.+ ...+....+.+|+.++|.|.+.+.|.+ .++|++++.. +................|.|.+++.+|+|.|+|.+
T Consensus         4 ~pP~~-~~~p~~~~~~~G~~v~l~C~~~g~p~~-~v~W~~~~~~-~~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~~   80 (284)
T 2rik_A            4 APPFF-DLKPVSVDLALGESGTFKCHVTGTAPI-KITWAKDNRE-IRPGGNYKMTLVENTATLTVLKVTKGDAGQYTCYA   80 (284)
T ss_dssp             CCCEE-EECCCCEEEETTCCEEEEEEEESSSCC-EEEEEETTEE-CCSSSSEEEEEETTEEEEEESSCCGGGCEEEEEEE
T ss_pred             CCCEE-EccccceEecCCCcEEEEEEEEcCCCC-EEEEEECCEE-CcCCCcEEEEEcCCEEEEEEecCCcccCEEEEEEE
Confidence            34444 445566778999999999998788988 9999999988 66554433333334568999999999999999999


Q ss_pred             EeCCCCCcccEEEEEEeccccCCCCCCCeEEEEcCCccCccceecCCcEEEEEEEEecCCCCeeEEEeCCeEEeeCCCCc
Q psy3823          90 RNEQGNQRTPCTFHVVKAGECEHPVDKPSVQIKLGRNLNASVLNEGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAG  169 (365)
Q Consensus        90 ~~~~~~~~~~~~l~V~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~g~~v~l~C~~~~~p~~~~i~W~~~~~~l~~~~~~~  169 (365)
                      .+..+.....+.|.|         ..+|.+...+.   ....+.+|+.+.|.|.+.+.|.+. +.|++++..+.......
T Consensus        81 ~n~~g~~~~~~~l~V---------~~~p~~~~~~~---~~~~v~~g~~~~l~C~~~g~p~~~-v~W~~~~~~~~~~~~~~  147 (284)
T 2rik_A           81 SNVAGKDSCSAQLGV---------QEPPRFIKKLE---PSRIVKQDEHTRYECKIGGSPEIK-VLWYKDETEIQESSKFR  147 (284)
T ss_dssp             EETTEEEEEEEEEEE---------ECCCEEEECCC---SEEEEETTCCEEEEEEEESSSCCE-EEEEETTEECCCSSSEE
T ss_pred             EECCceEEEEEEEEc---------cCCCcccccCC---CceEecCCceEEEEEEEeeeCCCE-EEEEECCEECcCCCcEE
Confidence            998887778888888         56776554332   234578999999999999988776 99999999887544322


Q ss_pred             eEE--eeceEEEeeecCCCCeEEEEEEEcCCCCCCcccEEEEEeeeeecccccCCCCceecCccceeeeecCceEEEEEE
Q psy3823         170 RII--TNQTLVLQSVTRHSGGLYACSAINSQGEGGSTPFDLNINKMVNLIFNSIDEPVCKQSQQRIYGALRNEQVLVSCT  247 (365)
Q Consensus       170 ~~~--~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~s~~~~l~v~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~l~C~  247 (365)
                      ...  ....|.|.+++..|+|.|+|.+.|..|... ..+.|.|.          .+|.+...+.. ..+..|+.+.|.|.
T Consensus       148 ~~~~~~~~~L~i~~~~~~d~G~Y~C~a~n~~g~~~-~~~~l~V~----------~~p~~~~~~~~-~~~~~g~~v~l~C~  215 (284)
T 2rik_A          148 MSFVESVAVLEMYNLSVEDSGDYTCEAHNAAGSAS-SSTSLKVK----------EPPVFRKKPHP-VETLKGADVHLECE  215 (284)
T ss_dssp             EEEETTEEEEEECSCCGGGCEEEEEEEECSSCEEE-EEEEEEEE----------CCCBCCSCCCC-EEECTTCCEEEEEE
T ss_pred             EEEcCCEEEEEECCCCcccCEEEEEEEEcCCCcee-EEEEEEEe----------cCCcceeCCCc-ceecCCCeEEEEEE
Confidence            222  256799999999999999999999988654 67788888          78877654433 33789999999999


Q ss_pred             EeeeCCCceeEEEeCCCCCCCCCCceeEeeCCCEEEEEEcCCCcccCeEEEEEEEcCCccceecEEEEEE
Q psy3823         248 VDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWARNEQGSQRTPCTFHVV  317 (365)
Q Consensus       248 ~~~~p~~~~~~W~~~~~~~~~~~~~~~~~~~~~~s~l~i~~v~~~d~G~Y~C~a~n~~g~~~~~~~l~v~  317 (365)
                      +.+.|.+. +.|++++.... .........++....|.|.+++.+|+|.|+|.|.|..|..+..+.|.|.
T Consensus       216 ~~g~p~~~-v~W~~~~~~~~-~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~a~N~~G~~~~~~~l~V~  283 (284)
T 2rik_A          216 LQGTPPFQ-VSWHKDKRELR-SGKKYKIMSENFLTSIHILNVDSADIGEYQCKASNDVGSYTCVGSITLK  283 (284)
T ss_dssp             CBSSSCCE-EEEEETTEEEC-BTTTEEEEEETTEEEEEECSCCGGGCEEEEEEEEETTEEEEEEEEEEEC
T ss_pred             EEecCCCE-EEEEECCEECc-CCCCEEEEEcCCEEEEEEcCCCcccCEEEEEEEEeCCCceeEEEEEEEc
Confidence            99999998 99999886433 2334444555666789999999999999999999999999988888775



>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>3u1s_H FAB PGT145 heavy chain; IGG, broadly neutralizing antibody, HIV-1 GP120, immune SYST; HET: TYS; 2.30A {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 5e-06
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 8e-06
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 1e-05
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-05
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 6e-05
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 7e-05
d2fcba288 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (C 8e-05
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 1e-04
d1fnla289 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (C 2e-04
d1l6za296 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, 2e-04
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 2e-04
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 6e-04
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 3e-04
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 3e-04
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 4e-04
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 4e-04
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 4e-04
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 7e-04
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 0.001
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 0.002
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 9e-04
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 0.001
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 0.001
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 0.001
d1f2qa289 b.1.1.4 (A:86-174) IgE high affinity receptor alph 0.001
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 0.002
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 0.002
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 0.003
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 0.003
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Axonin-1
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score = 42.6 bits (99), Expect = 5e-06
 Identities = 16/76 (21%), Positives = 25/76 (32%)

Query: 134 EGVDIYFDCHIQANPPYKKLIWTHNGITISNNASAGRIITNQTLVLQSVTRHSGGLYACS 193
               +   C  +ANPP       +         S  R++    ++   V     G Y C 
Sbjct: 21  AEEKVTLTCRARANPPATYRWKMNGTELKMGPDSRYRLVAGDLVISNPVKAKDAGSYQCV 80

Query: 194 AINSQGEGGSTPFDLN 209
           A N++G   S    L 
Sbjct: 81  ATNARGTVVSREASLR 96


>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.59
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.57
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.56
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.55
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.55
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.53
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.53
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.53
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.52
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.52
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.51
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.5
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.5
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.5
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.49
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.48
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.48
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.47
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.47
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.47
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.47
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.46
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.45
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.45
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.44
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.44
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.43
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.43
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.43
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.43
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.42
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.42
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.42
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.42
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.41
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.41
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.41
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.4
d2avga1110 Cardiac myosin binding protein C, different domain 99.4
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.39
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.39
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.39
d1gxea_130 Cardiac myosin binding protein C, different domain 99.38
d1gxea_130 Cardiac myosin binding protein C, different domain 99.37
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.37
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.37
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.37
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.36
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.36
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.36
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.35
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.35
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.35
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.35
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.34
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.34
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.34
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.33
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.33
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.33
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.33
d2avga1110 Cardiac myosin binding protein C, different domain 99.32
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.31
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.31
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.31
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.31
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.31
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.31
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.3
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.3
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.29
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.29
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.29
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.28
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.27
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.27
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.27
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.27
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.26
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.26
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.26
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.26
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.26
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.25
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.25
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.23
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.22
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.22
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.22
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.21
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.21
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.21
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.21
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.2
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.2
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.2
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.2
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.19
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.17
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.17
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.17
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.15
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.15
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.13
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.13
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.13
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.12
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.11
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.1
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.09
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.97
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.94
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.93
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 98.92
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.8
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.77
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.69
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.69
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.68
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.64
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.62
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.54
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 98.54
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.52
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.5
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.49
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.46
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.43
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.43
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.42
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.41
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.41
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.4
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.4
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.39
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.36
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.36
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.36
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.35
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.35
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.35
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.34
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.33
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.32
d1w72l1109 Immunoglobulin light chain lambda variable domain, 98.31
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 98.31
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.31
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.3
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.3
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.3
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.29
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 98.29
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.29
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.29
d2rhea_114 Immunoglobulin light chain lambda variable domain, 98.28
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.28
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.27
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 98.26
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 98.26
d1lgva1112 Immunoglobulin light chain lambda variable domain, 98.26
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.26
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 98.25
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.25
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.25
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.24
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.24
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.22
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.22
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 98.22
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.22
d1nfde1108 Immunoglobulin light chain lambda variable domain, 98.21
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.21
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 98.19
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 98.18
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.17
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.16
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.15
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 98.15
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 98.15
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.15
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 98.15
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 98.14
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.14
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 98.14
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.14
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.13
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 98.13
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 98.12
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.11
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 98.11
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.1
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 98.1
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.08
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.08
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.07
d1mjul1112 Immunoglobulin light chain kappa variable domain, 98.07
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.07
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 98.06
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.06
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.06
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 98.05
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 98.05
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 98.05
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.04
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 98.04
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.03
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 98.03
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 98.03
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.03
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 98.03
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 98.02
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 98.02
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 98.02
d1oaql_110 Immunoglobulin light chain lambda variable domain, 98.01
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 98.01
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 98.01
d2gsia1111 Immunoglobulin light chain kappa variable domain, 98.01
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 98.01
d1j05a_111 Immunoglobulin light chain kappa variable domain, 98.0
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 97.99
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.99
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.99
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 97.99
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 97.99
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 97.98
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.98
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 97.98
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.97
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.97
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.97
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.97
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 97.95
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.95
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.95
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.95
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.95
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.95
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.94
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 97.94
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.94
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.94
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 97.93
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 97.93
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 97.92
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 97.92
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 97.92
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.91
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 97.91
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.91
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.91
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.91
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 97.9
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.9
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.89
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 97.89
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 97.88
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.88
d8faba1103 Immunoglobulin light chain lambda variable domain, 97.88
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.88
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.88
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.87
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.87
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.86
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 97.86
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 97.86
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.85
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.85
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 97.85
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.85
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 97.84
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 97.84
d1jhll_108 Immunoglobulin light chain kappa variable domain, 97.84
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 97.83
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 97.83
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 97.82
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 97.82
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 97.81
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 97.81
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.81
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.81
d1d5il1107 Immunoglobulin light chain kappa variable domain, 97.8
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 97.78
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 97.78
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.78
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.77
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 97.77
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.77
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 97.77
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 97.76
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 97.76
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 97.76
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.75
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 97.75
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.75
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 97.74
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.74
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 97.73
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 97.72
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 97.71
d1mjul2107 Immunoglobulin light chain kappa constant domain, 97.71
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.71
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.7
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.7
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 97.69
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 97.68
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 97.68
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.68
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 97.66
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 97.65
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 97.65
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 97.65
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.65
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 97.64
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.64
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.62
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.62
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.6
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 97.6
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.59
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 97.59
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 97.58
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 97.58
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.58
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.56
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 97.56
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 97.55
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 97.54
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 97.54
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.53
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 97.53
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 97.52
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 97.52
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 97.51
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 97.49
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.48
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.48
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 97.47
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 97.47
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 97.46
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.44
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 97.44
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.44
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.43
d1nfde2104 Immunoglobulin light chain lambda constant domain, 97.42
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.42
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.42
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.41
d1nfde2104 Immunoglobulin light chain lambda constant domain, 97.4
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 97.39
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 97.39
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 97.37
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 97.36
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.35
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 97.34
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 97.34
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.33
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 97.31
d1mjul2107 Immunoglobulin light chain kappa constant domain, 97.31
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 97.29
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 97.26
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.26
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 97.2
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 97.2
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.19
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 97.19
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 97.18
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.18
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 97.18
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 97.18
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.17
d1c5ch2103 Immunoglobulin heavy chain gamma constant domain 1 97.15
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.15
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.14
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 97.14
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 97.14
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.13
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 97.13
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.09
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 97.08
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.08
d1l6xa1105 Immunoglobulin heavy chain gamma constant domain 2 97.05
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.05
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 97.05
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.05
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 97.05
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.05
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 97.03
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.02
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 97.02
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.0
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 96.99
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 96.99
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 96.98
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.97
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 96.97
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.96
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 96.95
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.95
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 96.93
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.9
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 96.89
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.89
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 96.87
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 96.86
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 96.86
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 96.85
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 96.85
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 96.84
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 96.82
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 96.82
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 96.82
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.81
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.81
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 96.8
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 96.79
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 96.79
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 96.78
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 96.78
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.77
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 96.75
d1ow0a1101 Immunoglobulin heavy chain alpha constant domain 2 96.75
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 96.75
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 96.73
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 96.73
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 96.73
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 96.72
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 96.71
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 96.71
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 96.71
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 96.71
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.7
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 96.7
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.7
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.69
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 96.69
d1ow0a1101 Immunoglobulin heavy chain alpha constant domain 2 96.68
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 96.68
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 96.66
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.66
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 96.66
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 96.65
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 96.65
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.65
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 96.65
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 96.64
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 96.64
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.64
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.63
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 96.63
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 96.63
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.63
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.61
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.61
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 96.61
d1fp5a1103 Immunoglobulin heavy chain epsilon constant domain 96.6
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.6
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 96.6
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.59
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.59
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.59
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 96.58
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.57
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.57
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 96.57
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 96.55
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 96.55
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 96.55
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 96.54
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.54
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 96.54
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 96.53
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 96.53
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.51
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 96.49
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 96.49
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 96.48
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 96.47
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 96.47
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 96.45
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 96.45
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 96.44
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.44
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.44
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 96.43
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.43
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.42
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 96.42
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 96.42
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 96.41
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.41
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 96.38
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 96.38
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.38
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 96.38
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Titin
species: Human (Homo sapiens), different modules [TaxId: 9606]
Probab=99.59  E-value=6.3e-15  Score=104.58  Aligned_cols=94  Identities=11%  Similarity=0.080  Sum_probs=75.3

Q ss_pred             CCceecCccceeeeecCceEEEEEEEeeeCCCceeEEEeCCCCCCCCCCceeEeeCCCEEEEEEcCCCcccCeEEEEEEE
Q psy3823         223 EPVCKQSQQRIYGALRNEQVLVSCTVDANPQAQYFTWAFNNSDTAPRPLTSYSIQDGSTSVARYTPTSELEYGTLLCWAR  302 (365)
Q Consensus       223 ~p~~~~~~~~~~~~~~g~~~~l~C~~~~~p~~~~~~W~~~~~~~~~~~~~~~~~~~~~~s~l~i~~v~~~d~G~Y~C~a~  302 (365)
                      +|.+...... ..+.+|+.+.|.|.+.|.|.|. +.|++++...............+..+.|.|.++..+|+|.|+|.|.
T Consensus         4 aP~f~~~~~~-~~v~~g~~v~l~c~v~g~P~p~-v~W~k~~~~i~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~c~a~   81 (98)
T d1g1ca_           4 APKIFERIQS-QTVGQGSDAHFRVRVVGKPDPE-CEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTGEDSASIMVKAI   81 (98)
T ss_dssp             EEEEEECCCC-EEEETTSCEEEEEEEEEESCCE-EEEEETTEECCCCSSEEEEEEETTEEEEEECSCCGGGCEEEEEEEE
T ss_pred             CCeEecCCCc-EEEcCCCcEEEEEEEEEecCCe-EEEEeCceEEeeeeeeEEEeccceEEEEEeccCccccCEEEEEEEE
Confidence            4555544433 3388999999999999999998 9999998755443333333445567789999999999999999999


Q ss_pred             cCCccceecEEEEEEc
Q psy3823         303 NEQGSQRTPCTFHVVK  318 (365)
Q Consensus       303 n~~g~~~~~~~l~v~~  318 (365)
                      |..|..+..+.|.|+.
T Consensus        82 N~~G~~~~~~~L~V~~   97 (98)
T d1g1ca_          82 NIAGETSSHAFLLVQA   97 (98)
T ss_dssp             ETTEEEEEEEEEEEEC
T ss_pred             ECCcEEEEEEEEEEEE
Confidence            9999999999998875



>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure