Diaphorina citri psyllid: psy3827

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-

MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGASFSESLSSLTTAAGKSSGKAVKKAGKAQKNIAKSDKKKKHRRKESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKCRAKTKQEEGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQVDGSAGSDALGVVALAQETVDSSDGELDTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

cccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHccccccccccHHHHHHcHHHHHHHHcccEECccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccHHcHHHHHHHHHHHcccccccccccccccccccHHHHHHEEEEEcccEEEEccccccEEEEccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccHHHHHHHHHHcccc

**********************LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGD*****************SLDVVTEYFPVPLG**********************************************YAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHA***********************EGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDG***********LG***********************************************************YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone H3.2	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	Q71DI3
Histone H3.2	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	Q4QRF4
Histone H3	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.	very confident	P02299

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031618 [CC]	nuclear centromeric heterochromatin	confident	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0000775, GO:0005720, GO:0005721, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0031934 [CC]	mating-type region heterochromatin	confident	GO:0044446, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0000792, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0031933 [CC]	telomeric heterochromatin	confident	GO:0000792, GO:0005575, GO:0043232, GO:0044464, GO:0044446, GO:0005623, GO:0005622, GO:0000781, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0007596 [BP]	blood coagulation	confident	GO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0000003 [BP]	reproduction	confident	GO:0008150
GO:0006281 [BP]	DNA repair	confident	GO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005654 [CC]	nucleoplasm	confident	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005657 [CC]	replication fork	confident	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0060465 [BP]	pharynx development	confident	GO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0010171 [BP]	body morphogenesis	confident	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0022402 [BP]	cell cycle process	confident	GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0040011 [BP]	locomotion	confident	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	confident	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0050830 [BP]	defense response to Gram-positive bacterium	confident	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0000794 [CC]	condensed nuclear chromosome	confident	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0050829 [BP]	defense response to Gram-negative bacterium	confident	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0002119 [BP]	nematode larval development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0005811 [CC]	lipid particle	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0060968 [BP]	regulation of gene silencing	confident	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0006996 [BP]	organelle organization	confident	GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0001673 [CC]	male germ cell nucleus	confident	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0006915 [BP]	apoptotic process	confident	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0000077 [BP]	DNA damage checkpoint	confident	GO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988
GO:0001741 [CC]	XY body	confident	GO:0043232, GO:0044464, GO:0000803, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0005700 [CC]	polytene chromosome	confident	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0009792 [BP]	embryo development ending in birth or egg hatching	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0003684 [MF]	damaged DNA binding	confident	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0040007 [BP]	growth	confident	GO:0008150
GO:0005576 [CC]	extracellular region	confident	GO:0005575
GO:0051298 [BP]	centrosome duplication	probable	GO:0006996, GO:0031023, GO:0007010, GO:0051297, GO:0009987, GO:0007098, GO:0016043, GO:0008150, GO:0000226, GO:0007017, GO:0044763, GO:0044699, GO:0071840, GO:0022402, GO:0007049
GO:0008360 [BP]	regulation of cell shape	probable	GO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0009303 [BP]	rRNA transcription	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0006334 [BP]	nucleosome assembly	probable	GO:0034728, GO:0071103, GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0031497, GO:0034622, GO:0044699, GO:0071824, GO:0006139, GO:0044260, GO:0006325, GO:1901360, GO:0006323, GO:0065003, GO:0071704, GO:0071840, GO:0065004, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0006333, GO:0044237, GO:0043170, GO:0044085, GO:0006259, GO:0008150
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0031298 [CC]	replication fork protection complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0048555 [CC]	generative cell nucleus	probable	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042692 [BP]	muscle cell differentiation	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0044699
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0019899 [MF]	enzyme binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0043935 [BP]	sexual sporulation resulting in formation of a cellular spore	probable	GO:0032502, GO:0022414, GO:0048610, GO:0000003, GO:0030435, GO:0009653, GO:0048869, GO:0008150, GO:0030154, GO:0019953, GO:0044699, GO:0034293, GO:0044767, GO:0003006, GO:0022402, GO:0007049, GO:0044763, GO:0009987, GO:0043934, GO:0048646, GO:0048856
GO:0001649 [BP]	osteoblast differentiation	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048869, GO:0030154, GO:0001503, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0043581 [BP]	mycelium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0006997 [BP]	nucleus organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0042393 [MF]	histone binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0070911 [BP]	global genome nucleotide-excision repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0000788 [CC]	nuclear nucleosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000786, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043231, GO:0032991, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0007420 [BP]	brain development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0007140 [BP]	male meiosis	probable	GO:0007126, GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0007094 [BP]	mitotic spindle assembly checkpoint	probable	GO:0045841, GO:0033043, GO:0051129, GO:0051128, GO:0010948, GO:0022402, GO:1901990, GO:0030071, GO:0044699, GO:0031577, GO:0007346, GO:0045786, GO:0010564, GO:0050789, GO:0008150, GO:0065007, GO:0007049, GO:0045839, GO:0007088, GO:0071174, GO:0071173, GO:1902100, GO:0009987, GO:0050794, GO:1901987, GO:0044763, GO:0048519, GO:1902099, GO:1901988, GO:0000075, GO:0051726, GO:0010639, GO:0051783, GO:0051784, GO:1901991, GO:0048523, GO:0007093
GO:0035267 [CC]	NuA4 histone acetyltransferase complex	probable	GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0043189, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0001740 [CC]	Barr body	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0000805, GO:0000803, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018991 [BP]	oviposition	probable	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0000723 [BP]	telomere maintenance	probable	GO:0060249, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0042592, GO:0065007, GO:0044699, GO:0065008, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0032200, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0000724 [BP]	double-strand break repair via homologous recombination	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0009725 [BP]	response to hormone stimulus	probable	GO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0007155 [BP]	cell adhesion	probable	GO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0030702 [BP]	chromatin silencing at centromere	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:0006342, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0000939 [CC]	condensed chromosome inner kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0000793, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000779, GO:0043229, GO:0043228, GO:0044422, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0000776, GO:0000777
GO:0009567 [BP]	double fertilization forming a zygote and endosperm	probable	GO:0044702, GO:0000003, GO:0009566, GO:0019953, GO:0022414, GO:0008150, GO:0044699
GO:0010212 [BP]	response to ionizing radiation	probable	GO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0048235 [BP]	pollen sperm cell differentiation	probable	GO:0048610, GO:0030154, GO:0019953, GO:0007275, GO:0044699, GO:0048229, GO:0000003, GO:0009555, GO:0048869, GO:0007276, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0022414, GO:0055046, GO:0044763, GO:0022412, GO:0048232, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0008150
GO:0051382 [BP]	kinetochore assembly	probable	GO:0022607, GO:0051383, GO:0070271, GO:0043933, GO:0034508, GO:0034622, GO:0071840, GO:0071824, GO:0071822, GO:0016043, GO:0065003, GO:0044699, GO:0065004, GO:0006461, GO:0009987, GO:0044763, GO:0070925, GO:0043623, GO:0006996, GO:0051276, GO:0044085, GO:0008150
GO:0006605 [BP]	protein targeting	probable	GO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0051320 [BP]	S phase	probable	GO:0051325, GO:0007049, GO:0009987, GO:0008150, GO:0044763, GO:0022403, GO:0022402, GO:0044699
GO:0006007 [BP]	glucose catabolic process	probable	GO:0071704, GO:0019320, GO:1901575, GO:0005975, GO:0044238, GO:0046365, GO:0005996, GO:0019318, GO:0016052, GO:0008150, GO:0008152, GO:0044723, GO:0006006, GO:0009056, GO:0044724
GO:0000778 [CC]	condensed nuclear chromosome kinetochore	probable	GO:0031974, GO:0000780, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000779, GO:0000794, GO:0000775, GO:0000776, GO:0000777, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0000793, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0071459 [BP]	protein localization to chromosome, centromeric region	probable	GO:0008104, GO:0034502, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0000132 [BP]	establishment of mitotic spindle orientation	probable	GO:0008104, GO:0051653, GO:0007163, GO:0000226, GO:0030010, GO:0051656, GO:0044699, GO:0040001, GO:0071840, GO:0016043, GO:0008150, GO:0007049, GO:0033036, GO:0006996, GO:0000278, GO:0051294, GO:0009987, GO:0051293, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0031503, GO:0007017, GO:0007010, GO:0022402
GO:0045739 [BP]	positive regulation of DNA repair	probable	GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0006282, GO:0051052, GO:0060255, GO:0048583, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:2001020, GO:2001022, GO:0080134, GO:0080135, GO:0048522

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NQB, chain C
Confidence level:very confident
Coverage over the Query: 16-115
View the alignment between query and template
View the model in PyMOL

Template: 2NQB, chain D
Confidence level:very confident
Coverage over the Query: 240-330
View the alignment between query and template
View the model in PyMOL

Template: 1TZY, chain C
Confidence level:very confident
Coverage over the Query: 487-581
View the alignment between query and template
View the model in PyMOL