Psyllid ID: psy3827

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-
MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGASFSESLSSLTTAAGKSSGKAVKKAGKAQKNIAKSDKKKKHRRKESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKCRAKTKQEEGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQVDGSAGSDALGVVALAQETVDSSDGELDTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
cccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHccccccccccHHHHHHcHHHHHHHHcccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccHHcHHHHHHHHHHHccccccccccccccccccHHHHHHHEEEEEcccEEEEccccccEEEEccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccHHHHHHHHHHcccc
ccccccccccccccccHHHHHcccccHHHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHcHHHHHHcccEEEccccccccccHcccHHHcEccccccccccEEEEcccccccccHHHHHHHHcccccEEcccccccccccccccccccccccHHHHHHHccHHHHcccccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHccccccccHEHHHHHccccccccccccccccccccHHHHHHHEEEEcccEEEEcccccEEEEEcHHHHHHHHHccHEEEcccccccccccccccEEcccccccccccccccccEccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHccccc
msgrgkggkakaksktrssraglqfpvgrIHRLLRkgnyaervgagAPVYLAAVMEYLAAEVLELAGnaardnkktriiPRHLQLAIRNDEELNKLLSgvtiaqggvlpniqagaaltfervddvhggdglslgvlgvgdgVADHVLEEHLENatgllvdepgdtldststrqttdgglgdsldvvteyfpvplgasfsesLSSLTTAAGKSSGKAVKKAGKAQKNIaksdkkkkhrrkESYAIYIYKVLKQvhpdtgvsSKAMSIMNSFVNDIFERIAAESSRLahynkrstiTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKCRAKTKQEEGALGFLFGLLgqehgldvgqnsslgdgdaGQELVQLFVVAdgqlqvtgddtGLLVVTCGVagqlenfsgqilhdggqvdgsagsDALGVVALAQetvdssdgelDTMARTKQTArkstggkaprkQLATKAarksapatggvkkphryrpgtVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
msgrgkggkakaksktrssraglqfpvgrihrllrkgnyaerVGAGAPVYLAAVMEYLAAEVLELAGnaardnkktriiPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENAtgllvdepgdtLDSTStrqttdgglgdsLDVVTEYFPVPLGASFSESLSSLTTAagkssgkavkkagkaqkniaksdkkkkhrrkeSYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLahynkrstitsreIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKCRAKTKQEEGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQVDGSAGSDALGVVALAQetvdssdgeldtmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreIRRYQKSTellirklpfqrLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIhakrvtimpkdiqlarrirgera
MsgrgkggkakaksktrssragLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERvddvhggdglslgvlgvgdgvadhvlEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGASFSESLSSLTTaagkssgkavkkagkaQKNIAksdkkkkhrrkESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKCRAKTKqeegalgflfgllgqehglDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQVDGSAGSDALGVVALAQETVDSSDGELDTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
**********************LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLV**********************SLDVVTEYFPVPLG**********************************************YAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS****AVTKY************EGALGFLFGLLGQEHGLDVGQ******GDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQV*******ALGVVAL**********************************************************GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLA********
*************************PVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQA********************************VLEEHLENATGLLVDEPGD*****************************************************************************YAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHA*************************ALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQ*****************************************************************************YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG***
*********************GLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGASFSESLSS**********************************KESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHA*******************TKQEEGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQVDGSAGSDALGVVALAQETVDSSDGELDTMA************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
*********************GLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGA*******************************************ESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKCRA***QEEGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDG********S**LG*****************T**************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGRGKGGKAKAKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAGAALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQTTDGGLGDSLDVVTEYFPVPLGASFSESLSSLTTAAGKSSGKAVKKAGKAQKNIAKSDKKKKHRRKESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKCRAKTKQEEGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVADGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQVDGSAGSDALGVVALAQETVDSSDGELDTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query581 2.2.26 [Sep-21-2011]
P84239136 Histone H3 OS=Urechis cau N/A N/A 0.234 1.0 1.0 6e-74
P84237136 Histone H3 OS=Tigriopus c N/A N/A 0.234 1.0 1.0 6e-74
P84235136 Histone H3 OS=Platynereis N/A N/A 0.234 1.0 1.0 6e-74
P02299136 Histone H3 OS=Drosophila yes N/A 0.234 1.0 1.0 6e-74
P84236136 Histone H3 OS=Drosophila N/A N/A 0.234 1.0 1.0 6e-74
P84238136 Histone H3 OS=Chironomus N/A N/A 0.234 1.0 1.0 6e-74
Q28D37136 Histone H3.2 OS=Xenopus t no N/A 0.234 1.0 1.0 6e-74
P84233136 Histone H3.2 OS=Xenopus l N/A N/A 0.234 1.0 1.0 6e-74
P84232136 Histone H3.2 OS=Poroderma N/A N/A 0.234 1.0 1.0 6e-74
P84234136 Histone H3.2 OS=Oncorhync N/A N/A 0.234 1.0 1.0 6e-74
>sp|P84239|H3_URECA Histone H3 OS=Urechis caupo PE=1 SV=2 Back     alignment and function desciption
 Score =  279 bits (713), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%)

Query: 446 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 505
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 506 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 565
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 566 MPKDIQLARRIRGERA 581
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Urechis caupo (taxid: 6431)
>sp|P84237|H3_TIGCA Histone H3 OS=Tigriopus californicus PE=3 SV=2 Back     alignment and function description
>sp|P84235|H3_PLADU Histone H3 OS=Platynereis dumerilii PE=3 SV=2 Back     alignment and function description
>sp|P02299|H3_DROME Histone H3 OS=Drosophila melanogaster GN=His3 PE=1 SV=4 Back     alignment and function description
>sp|P84236|H3_DROHY Histone H3 OS=Drosophila hydei GN=His3 PE=3 SV=2 Back     alignment and function description
>sp|P84238|H3_CHITH Histone H3 OS=Chironomus thummi thummi PE=3 SV=2 Back     alignment and function description
>sp|Q28D37|H32_XENTR Histone H3.2 OS=Xenopus tropicalis GN=TGas081o10.1 PE=2 SV=3 Back     alignment and function description
>sp|P84233|H32_XENLA Histone H3.2 OS=Xenopus laevis PE=1 SV=2 Back     alignment and function description
>sp|P84232|H32_PORAF Histone H3.2 OS=Poroderma africanum PE=1 SV=2 Back     alignment and function description
>sp|P84234|H32_ONCMY Histone H3.2 OS=Oncorhynchus mykiss PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query581
395736868 763 PREDICTED: uncharacterized protein LOC10 0.760 0.579 0.507 1e-117
344242825320 Histone H3.1t [Cricetulus griseus] 0.481 0.875 0.657 1e-117
392354344 731 PREDICTED: uncharacterized protein LOC67 0.512 0.407 0.637 1e-116
426251332 835 PREDICTED: uncharacterized protein LOC10 0.425 0.295 0.670 1e-92
449481769502 PREDICTED: uncharacterized protein LOC10 0.413 0.478 0.642 1e-86
432843748397 PREDICTED: uncharacterized protein LOC10 0.313 0.458 0.696 2e-81
170059756158 histone H3.3 type 2 [Culex quinquefascia 0.263 0.968 0.901 4e-74
432843434147 PREDICTED: histone H3.2-like [Oryzias la 0.251 0.993 0.952 6e-74
391344312277 PREDICTED: uncharacterized protein LOC10 0.232 0.487 1.0 3e-73
328699746157 PREDICTED: histone H3-like [Acyrthosipho 0.249 0.923 0.952 4e-73
>gi|395736868|ref|XP_002816553.2| PREDICTED: uncharacterized protein LOC100436122, partial [Pongo abelii] Back     alignment and taxonomy information
 Score =  430 bits (1105), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 255/502 (50%), Positives = 310/502 (61%), Gaps = 60/502 (11%)

Query: 115 AALTFERVDDVHGGDGLSLGVLGVGDGVADHVLEEHLENATGLLVDEPGDTLDSTSTRQT 174
           A+LTFERV+ +HG   L+LGVL VG  V DH+L+EHLEN TGLL+++  D+L  T+  + 
Sbjct: 287 ASLTFERVNHIHGSHSLALGVLRVGHSVPDHILQEHLENTTGLLINQTRDSLYPTTPSKA 346

Query: 175 TDGGLGDSLDVVTEYFPV-------------------------PLGASFSESLSSLTTAA 209
            +G LGDSLDV+ ++FPV                         PLG    E L+    + 
Sbjct: 347 PNGRLGDSLDVIPQHFPVTLSTSFTQTFTAFATTRHGYSAQNKPLGFKTDEKLTLHLRSL 406

Query: 210 GKSSGKAVKKAGKAQKNIAKSDKKKKHRRKESYAIYIYKVLKQ------VHPDTGVSSKA 263
             ++   +   G    ++   D  K    KE Y    +++  Q      V  D   S  A
Sbjct: 407 SANAASELDVLGHNSHSLG-MDGAKVCVLKEPYQALEWQLPNQQLGRLLVATDLAQSHSA 465

Query: 264 MSIMNSFVNDIFERIAAESSRLAHY--NKRSTITSREIQTAVRLLLPGELAK--HAVSEG 319
            ++               + RL H   ++R+  +    Q   R    G LA    + S G
Sbjct: 466 RAV---------------TVRLFHAAGSRRAFASGLGSQLLARRFTAGGLASCLFSTSHG 510

Query: 320 TKAVTKYTSSKCRAKTKQEEGALGFLFGLLGQEHGLDVGQNSSLGDGDAGQELVQLFVVA 379
            K         C  K KQ    L F +    +++ L++ QN++L DG   Q+L++LFVVA
Sbjct: 511 KKTENLACRDVCGGKEKQ----LLFFY----RQYRLNIRQNATLRDGHTPQKLIKLFVVA 562

Query: 380 DGQLQVTGDDTGLLVVTCGVAGQLENFSGQILHDGGQVDGSAGSDALGVVALAQETVDSS 439
           DGQLQV  DD GLLVV   +A QL++  GQ+L    ++   AG DALGVVA A++     
Sbjct: 563 DGQLQVARDDAGLLVVAGRIARQLQDLGGQVLKHRRKIHRRAGPDALGVVAFAEQAF-LK 621

Query: 440 DGELDTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR 499
           +G +  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR
Sbjct: 622 EGVIFQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRR 681

Query: 500 YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIH 559
           YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA EAYLVGLFEDTNLCAIH
Sbjct: 682 YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIH 741

Query: 560 AKRVTIMPKDIQLARRIRGERA 581
           AKRVTIMPKDIQLARRIRGERA
Sbjct: 742 AKRVTIMPKDIQLARRIRGERA 763

Source: Pongo abelii

Species: Pongo abelii

Genus: Pongo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|344242825|gb|EGV98928.1| Histone H3.1t [Cricetulus griseus] Back     alignment and taxonomy information
>gi|392354344|ref|XP_003751747.1| PREDICTED: uncharacterized protein LOC679994 [Rattus norvegicus] Back     alignment and taxonomy information
>gi|426251332|ref|XP_004019378.1| PREDICTED: uncharacterized protein LOC101105787 [Ovis aries] Back     alignment and taxonomy information
>gi|449481769|ref|XP_004175938.1| PREDICTED: uncharacterized protein LOC100219617 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|432843748|ref|XP_004065646.1| PREDICTED: uncharacterized protein LOC101168343 [Oryzias latipes] Back     alignment and taxonomy information
>gi|170059756|ref|XP_001865500.1| histone H3.3 type 2 [Culex quinquefasciatus] gi|167878389|gb|EDS41772.1| histone H3.3 type 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|432843434|ref|XP_004065634.1| PREDICTED: histone H3.2-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|391344312|ref|XP_003746445.1| PREDICTED: uncharacterized protein LOC100902368 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|328699746|ref|XP_003241032.1| PREDICTED: histone H3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query581
UNIPROTKB|G1K329142 LOC768333 "Histone H3" [Gallus 0.242 0.992 0.978 8.2e-67
FB|FBgn0051613136 His3:CG31613 "His3:CG31613" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053803136 His3:CG33803 "His3:CG33803" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053806136 His3:CG33806 "His3:CG33806" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053809136 His3:CG33809 "His3:CG33809" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053812136 His3:CG33812 "His3:CG33812" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053815136 His3:CG33815 "His3:CG33815" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053818136 His3:CG33818 "His3:CG33818" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053821136 His3:CG33821 "His3:CG33821" [D 0.234 1.0 1.0 2.2e-66
FB|FBgn0053824136 His3:CG33824 "His3:CG33824" [D 0.234 1.0 1.0 2.2e-66
UNIPROTKB|G1K329 LOC768333 "Histone H3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 679 (244.1 bits), Expect = 8.2e-67, P = 8.2e-67
 Identities = 138/141 (97%), Positives = 138/141 (97%)

Query:   441 GELDTMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY 500
             GE   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY
Sbjct:     2 GEGCAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY 61

Query:   501 QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA 560
             QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA
Sbjct:    62 QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA 121

Query:   561 KRVTIMPKDIQLARRIRGERA 581
             KRVTIMPKDIQLARRIRGERA
Sbjct:   122 KRVTIMPKDIQLARRIRGERA 142
GO:0006334 "nucleosome assembly" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0000786 "nucleosome" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053812 His3:CG33812 "His3:CG33812" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053815 His3:CG33815 "His3:CG33815" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053818 His3:CG33818 "His3:CG33818" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053821 His3:CG33821 "His3:CG33821" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053824 His3:CG33824 "His3:CG33824" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P84235H3_PLADUNo assigned EC number1.00.23401.0N/AN/A
P84234H32_ONCMYNo assigned EC number1.00.23401.0N/AN/A
P84237H3_TIGCANo assigned EC number1.00.23401.0N/AN/A
P84236H3_DROHYNo assigned EC number1.00.23401.0N/AN/A
P84231H32_ICTBUNo assigned EC number1.00.23401.0N/AN/A
Q71DI3H32_HUMANNo assigned EC number1.00.23401.0yesN/A
P84233H32_XENLANo assigned EC number1.00.23401.0N/AN/A
P84232H32_PORAFNo assigned EC number1.00.23401.0N/AN/A
Q6LCK1H32_BRANANo assigned EC number0.97050.23401.0N/AN/A
Q64400H32_CRILONo assigned EC number0.99260.23401.0N/AN/A
P84239H3_URECANo assigned EC number1.00.23401.0N/AN/A
P84238H3_CHITHNo assigned EC number1.00.23401.0N/AN/A
P69078H3_SOLSTNo assigned EC number0.99260.23401.0N/AN/A
P69079H3_STRDRNo assigned EC number0.99260.23401.0N/AN/A
Q6LED0H31_RATNo assigned EC number0.99260.23401.0noN/A
P69072H3_LYTPINo assigned EC number0.99260.23401.0N/AN/A
P69073H3_PARLINo assigned EC number0.99260.23401.0N/AN/A
P69071H3_DERIMNo assigned EC number0.99260.23401.0N/AN/A
P69076H3_PSAMINo assigned EC number0.99260.23401.0N/AN/A
P69077H3_PYCHENo assigned EC number0.99260.23401.0N/AN/A
P69074H3_PISBRNo assigned EC number0.99260.23401.0N/AN/A
P84230H32_CAIMONo assigned EC number1.00.23401.0N/AN/A
Q71T45H32_EUPESNo assigned EC number0.97050.23401.0N/AN/A
P08898H3_CAEELNo assigned EC number0.97050.23401.0yesN/A
Q4QRF4H32_DANRENo assigned EC number1.00.23401.0yesN/A
Q28D37H32_XENTRNo assigned EC number1.00.23401.0noN/A
P59226H32_ARATHNo assigned EC number0.97050.23401.0yesN/A
P69246H32_MAIZENo assigned EC number0.97050.23401.0N/AN/A
P69248H32_PETCRNo assigned EC number0.97050.23401.0N/AN/A
P68428H32_WHEATNo assigned EC number0.97050.23401.0N/AN/A
P69075H3_PISOCNo assigned EC number0.99260.23401.0N/AN/A
P68427H32_PEANo assigned EC number0.97050.23401.0N/AN/A
P02299H3_DROMENo assigned EC number1.00.23401.0yesN/A
P84227H32_BOVINNo assigned EC number1.00.23401.0yesN/A
Q2RAD9H32_ORYSJNo assigned EC number0.97050.23401.0yesN/A
Q76MV0H32_TOBACNo assigned EC number0.97050.23401.0N/AN/A
P84228H32_MOUSENo assigned EC number1.00.23401.0yesN/A
P84229H32_CHICKNo assigned EC number1.00.23401.0yesN/A
Q6LBE8H32_MUSPANo assigned EC number1.00.23401.0N/AN/A
Q6LBE3H32_ASPOFNo assigned EC number0.97050.23401.0N/AN/A
A2Y533H32_ORYSINo assigned EC number0.97050.23401.0N/AN/A
Q6LBF0H31_MUSPANo assigned EC number0.99260.23401.0N/AN/A
P06352H3_STRPUNo assigned EC number0.98520.23401.0yesN/A
P68431H31_HUMANNo assigned EC number0.99260.23401.0yesN/A
P68430H32_ONOVINo assigned EC number0.97050.23401.0N/AN/A
P68433H31_MOUSENo assigned EC number0.99260.23401.0yesN/A
P68432H31_BOVINNo assigned EC number0.99260.23401.0yesN/A
P68429H32_MEDSANo assigned EC number0.97050.23401.0N/AN/A
P08903H32_ENCALNo assigned EC number0.97790.23401.0N/AN/A
P22843H3_ACRFONo assigned EC number0.98520.23401.0N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query581
PTZ00018136 PTZ00018, PTZ00018, histone H3; Provisional 7e-93
PLN00121136 PLN00121, PLN00121, histone H3; Provisional 4e-83
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 4e-63
smart00428105 smart00428, H3, Histone H3 6e-62
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 7e-62
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 9e-60
smart00414106 smart00414, H2A, Histone 2A 2e-58
smart0042797 smart00427, H2B, Histone H2B 7e-56
PLN00158116 PLN00158, PLN00158, histone H2B; Provisional 4e-51
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 4e-51
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 2e-49
PLN00161135 PLN00161, PLN00161, histone H3; Provisional 2e-48
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 2e-47
PTZ00463117 PTZ00463, PTZ00463, histone H2B; Provisional 3e-40
PLN0016097 PLN00160, PLN00160, histone H3; Provisional 3e-39
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 1e-35
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 1e-31
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 9e-31
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 1e-26
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 4e-23
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 2e-22
PLN0015558 PLN00155, PLN00155, histone H2A; Provisional 2e-18
COG5247113 COG5247, BUR6, Class 2 transcription repressor NC2 6e-05
>gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional Back     alignment and domain information 
 Score =  280 bits (718), Expect = 7e-93
 Identities = 130/136 (95%), Positives = 135/136 (99%)

Query: 446 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 505
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE 60

Query: 506 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 565
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 566 MPKDIQLARRIRGERA 581
           MPKDIQLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136

Length = 136
>gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|128705 smart00428, H3, Histone H3 Back     alignment and domain information
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|197718 smart00427, H2B, Histone H2B Back     alignment and domain information
>gnl|CDD|215081 PLN00158, PLN00158, histone H2B; Provisional Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|185642 PTZ00463, PTZ00463, histone H2B; Provisional Back     alignment and domain information
>gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 581
PTZ00018136 histone H3; Provisional 100.0
PLN00121136 histone H3; Provisional 100.0
PLN00158116 histone H2B; Provisional 100.0
PLN00161135 histone H3; Provisional 100.0
PTZ00463117 histone H2B; Provisional 100.0
KOG1745|consensus137 100.0
smart0042789 H2B Histone H2B. 100.0
PLN00153129 histone H2A; Provisional 100.0
PLN00157132 histone H2A; Provisional 100.0
KOG1744|consensus127 100.0
PTZ00017134 histone H2A; Provisional 100.0
PLN00156139 histone H2AX; Provisional 100.0
PLN0016097 histone H3; Provisional 100.0
KOG1756|consensus131 100.0
PTZ00252134 histone H2A; Provisional 100.0
smart00428105 H3 Histone H3. 100.0
PLN00154136 histone H2A; Provisional 100.0
smart00414106 H2A Histone 2A. 100.0
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 100.0
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 100.0
KOG1757|consensus131 100.0
PLN0015558 histone H2A; Provisional 99.85
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.82
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.65
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.18
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 98.75
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 98.62
PTZ00463117 histone H2B; Provisional 98.27
PLN00158116 histone H2B; Provisional 98.2
PLN00035103 histone H4; Provisional 98.12
KOG1659|consensus224 98.05
smart0042789 H2B Histone H2B. 98.01
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 97.93
KOG1744|consensus127 97.81
cd0007685 H4 Histone H4, one of the four histones, along wit 97.58
PTZ00015102 histone H4; Provisional 97.43
PLN00035103 histone H4; Provisional 97.42
smart0080365 TAF TATA box binding protein associated factor. TA 97.4
PTZ00015102 histone H4; Provisional 97.39
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 97.29
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 97.23
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 97.11
smart0080365 TAF TATA box binding protein associated factor. TA 96.91
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 96.68
smart0041774 H4 Histone H4. 96.56
KOG0870|consensus172 96.44
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 96.4
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 96.02
cd0007685 H4 Histone H4, one of the four histones, along wit 95.99
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 95.96
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 95.68
PF0296966 TAF: TATA box binding protein associated factor (T 95.22
smart0041774 H4 Histone H4. 95.14
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 94.75
smart0057677 BTP Bromodomain transcription factors and PHD doma 94.64
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 94.38
KOG1657|consensus236 93.9
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 93.69
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 93.26
KOG1142|consensus258 93.16
smart00428105 H3 Histone H3. 93.07
KOG0869|consensus168 92.45
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 91.67
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 90.56
PLN00156139 histone H2AX; Provisional 88.91
KOG1142|consensus258 88.88
KOG0871|consensus156 88.27
KOG3219|consensus195 86.95
PF0296966 TAF: TATA box binding protein associated factor (T 86.88
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 85.12
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 85.1
smart00414106 H2A Histone 2A. 84.68
PLN00157132 histone H2A; Provisional 84.66
KOG3334|consensus148 83.88
PLN00153129 histone H2A; Provisional 83.56
PTZ00017134 histone H2A; Provisional 83.44
>PTZ00018 histone H3; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-49  Score=366.37  Aligned_cols=135  Identities=96%  Similarity=1.342  Sum_probs=130.5

Q ss_pred             CccccccccCCCCCCCCccchhhhhhcccCCCCCCCCCCccCCCCcchhhhhhhcccchhhhhccCchhHHHHHHHhhcc
Q psy3827         446 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK  525 (581)
Q Consensus       446 MARtKqtArkstggkaPrK~la~k~arks~p~~~~~kk~~r~rpgt~alrEIR~yQkst~lLI~K~pF~RLVrEI~~~~~  525 (581)
                      |||||+++++++|+++|+++.++++.+++.+..++.++++||+||++||+|||+||+||+|||||+||+||||||+++|.
T Consensus         1 MaRtk~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~   80 (136)
T PTZ00018          1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_pred             CCCCCcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcC
Confidence            99999999999999999999988888887777788899999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHhhhhccchhhhhhhhcCCeeeeCcccHHHHHHHhccC
Q psy3827         526 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER  580 (581)
Q Consensus       526 ~~~Rfq~~Al~aLQeAaEayLv~lFEda~lcA~HaKRVTI~~kDiqLa~rIrg~~  580 (581)
                      +++|||++||+|||||+|+|||+||||+|+||+||||||||+|||||++||||++
T Consensus        81 ~~~rf~~~al~aLQeaaE~yLv~lfed~~lca~HakRVTl~~kD~~L~~rirg~~  135 (136)
T PTZ00018         81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER  135 (136)
T ss_pred             CcceeeHHHHHHHHHHHHHHHHHHhhhhHHHHHhhcceecchhhHHHHHHhcccC
Confidence            9999999999999999999999999999999999999999999999999999986

>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>KOG1744|consensus Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>KOG1756|consensus Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>KOG1757|consensus Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>KOG1659|consensus Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>KOG1744|consensus Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>KOG0870|consensus Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1657|consensus Back     alignment and domain information
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>KOG1142|consensus Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>KOG0869|consensus Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>KOG1142|consensus Back     alignment and domain information
>KOG0871|consensus Back     alignment and domain information
>KOG3219|consensus Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>KOG3334|consensus Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query581
2hio_C136 Histone Octamer (Chicken), Chromosomal Protein Leng 6e-75
3av1_A139 The Human Nucleosome Structure Containing The Histo 7e-75
3lel_A136 Structural Insight Into The Sequence-Dependence Of 2e-74
2cv5_A136 Crystal Structure Of Human Nucleosome Core Particle 3e-74
3afa_A139 The Human Nucleosome Structure Length = 139 3e-74
2io5_B135 Crystal Structure Of The Cia- Histone H3-H4 Complex 4e-74
3azh_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-74
3azg_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-74
3azf_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-74
3aze_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-74
3ayw_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-74
1kx3_A135 X-Ray Structure Of The Nucleosome Core Particle, Nc 1e-73
1f66_A136 2.6 A Crystal Structure Of A Nucleosome Core Partic 1e-73
3kxb_A135 Structural Characterization Of H3k56q Nucleosomes A 4e-73
3av2_A139 The Human Nucleosome Structure Containing The Histo 9e-73
1zla_A135 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 1e-72
4hga_B136 Structure Of The Variant Histone H3.3-H4 Heterodime 1e-72
3a6n_A139 The Nucleosome Containing A Testis-Specific Histone 1e-72
1p3b_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-72
1m18_A135 Ligand Binding Alters The Structure And Dynamics Of 4e-72
3c1c_A135 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 9e-72
1p3k_A135 Crystallographic Studies Of Nucleosome Core Particl 1e-71
1p3m_A135 Crystallographic Studies Of Nucleosome Core Particl 1e-71
1p3a_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-71
1p3l_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-71
1p34_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-71
4h9o_A135 Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length 1e-70
4h9n_A135 Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 3e-69
4h9s_A135 Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 2e-68
1id3_A135 Crystal Structure Of The Yeast Nucleosome Core Part 7e-65
4h9p_A135 Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length 1e-63
1aoi_A116 Complex Between Nucleosome Core Particle (H3,H4,H2a 1e-62
3kwq_A98 Structural Characterization Of H3k56q Nucleosomes A 7e-52
1hio_C93 Histone Octamer (Chicken), Chromosomal Protein, Alp 1e-48
2pyo_D122 Drosophila Nucleosome Core Length = 122 5e-48
2nqb_C123 Drosophila Nucleosome Structure Length = 123 8e-48
2pyo_C120 Drosophila Nucleosome Core Length = 120 1e-47
2nqb_D123 Drosophila Nucleosome Structure Length = 123 3e-47
3c9k_B125 Model Of Histone Octamer Tubular Crystals Length = 5e-46
1s32_D122 Molecular Recognition Of The Nucleosomal 'supergroo 5e-46
2f8n_H123 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 6e-46
1f66_D126 2.6 A Crystal Structure Of A Nucleosome Core Partic 6e-46
3c1b_D125 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 6e-46
1zla_D125 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 7e-46
1p34_D125 Crystallographic Studies Of Nucleosome Core Particl 7e-46
1kx3_D125 X-Ray Structure Of The Nucleosome Core Particle, Nc 8e-46
1aoi_D99 Complex Between Nucleosome Core Particle (H3,H4,H2a 1e-45
3kwq_D93 Structural Characterization Of H3k56q Nucleosomes A 1e-45
1u35_D126 Crystal Structure Of The Nucleosome Core Particle C 3e-45
1eqz_B126 X-Ray Structure Of The Nucleosome Core Particle At 3e-45
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 3e-45
2hio_B125 Histone Octamer (Chicken), Chromosomal Protein Leng 3e-45
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 4e-45
3a6n_D129 The Nucleosome Containing A Testis-Specific Histone 6e-45
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 7e-45
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 7e-45
2cv5_D126 Crystal Structure Of Human Nucleosome Core Particle 8e-45
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 8e-45
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 1e-44
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 1e-44
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 1e-44
2xql_B90 Fitting Of The H2a-H2b Histones In The Electron Mic 2e-44
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 2e-44
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 3e-44
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 3e-44
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 3e-44
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 1e-43
3an2_D129 The Structure Of The Centromeric Nucleosome Contain 3e-43
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 2e-42
1hio_B90 Histone Octamer (Chicken), Chromosomal Protein, Alp 6e-42
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 8e-42
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 7e-40
1id3_D130 Crystal Structure Of The Yeast Nucleosome Core Part 4e-39
2hue_B77 Structure Of The H3-h4 Chaperone Asf1 Bound To Hist 7e-38
4eo5_B76 Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 8e-38
2jss_A192 Nmr Structure Of Chaperone Chz1 Complexed With Hist 3e-37
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 6e-31
2yfv_A100 The Heterotrimeric Complex Of Kluyveromyces Lactis 1e-30
2yfw_A92 Heterotetramer Structure Of Kluyveromyces Lactis Cs 5e-29
3an2_A143 The Structure Of The Centromeric Nucleosome Contain 1e-25
3r45_A156 Structure Of A Cenp-A-Histone H4 Heterodimer In Com 2e-25
3nqu_A140 Crystal Structure Of Partially Trypsinized (Cenp-AH 2e-25
1f66_C128 2.6 A Crystal Structure Of A Nucleosome Core Partic 2e-25
2l5a_A 235 Structural Basis For Recognition Of Centromere Spec 3e-25
3nqj_A82 Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len 6e-20
2ly8_A121 The Budding Yeast Chaperone Scm3 Recognizes The Par 2e-14
4ft4_P32 Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 5e-09
3n9p_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 5e-08
3n9n_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P 5e-08
4hsu_C30 Crystal Structure Of Lsd2-npac With H3(1-26)in Spac 6e-08
4gu0_E26 Crystal Structure Of Lsd2 With H3 Length = 26 1e-05
3u5p_I28 Crystal Structure Of The Complex Of Trim33 Phd-Brom 6e-05
2p5b_I22 The Complex Structure Of Jmjd2a And Trimethylated H 8e-05
3a1b_A159 Crystal Structure Of The Dnmt3a Add Domain In Compl 1e-04
3ksy_A 1049 Crystal Structure Of The Histone Domain, Dh-Ph Unit 2e-04
1q9c_A191 Crystal Structure Of The Histone Domain Of Son Of S 2e-04
2x4w_B21 Molecular Basis Of Histone H3k36me3 Recognition By 3e-04
3kv4_B24 Structure Of Phf8 In Complex With Histone H3 Length 3e-04
3avr_B22 Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H 6e-04
>pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 Back     alignment and structure 
Iteration: 1

 Score =  278 bits (711), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%)
Query: 446 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 505
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
Query: 506 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 565
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120
Query: 566 MPKDIQLARRIRGERA 581
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136
>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 Back     alignment and structure
>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 Back     alignment and structure
>pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 Back     alignment and structure
>pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 Back     alignment and structure
>pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 Back     alignment and structure
>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 Back     alignment and structure
>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 Back     alignment and structure
>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 Back     alignment and structure
>pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 Back     alignment and structure
>pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 Back     alignment and structure
>pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 Back     alignment and structure
>pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 Back     alignment and structure
>pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 Back     alignment and structure
>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 Back     alignment and structure
>pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 Back     alignment and structure
>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 Back     alignment and structure
>pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 Back     alignment and structure
>pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 Back     alignment and structure
>pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 Back     alignment and structure
>pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 Back     alignment and structure
>pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 Back     alignment and structure
>pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 Back     alignment and structure
>pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 Back     alignment and structure
>pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 Back     alignment and structure
>pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 Back     alignment and structure
>pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 Back     alignment and structure
>pdb|2PYO|D Chain D, Drosophila Nucleosome Core Length = 122 Back     alignment and structure
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure
>pdb|2NQB|D Chain D, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|3C9K|B Chain B, Model Of Histone Octamer Tubular Crystals Length = 125 Back     alignment and structure
>pdb|1S32|D Chain D, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 122 Back     alignment and structure
>pdb|2F8N|H Chain H, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 123 Back     alignment and structure
>pdb|1F66|D Chain D, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 126 Back     alignment and structure
>pdb|3C1B|D Chain D, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 125 Back     alignment and structure
>pdb|1ZLA|D Chain D, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 125 Back     alignment and structure
>pdb|1P34|D Chain D, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 125 Back     alignment and structure
>pdb|1KX3|D Chain D, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 125 Back     alignment and structure
>pdb|1AOI|D Chain D, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 99 Back     alignment and structure
>pdb|3KWQ|D Chain D, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 93 Back     alignment and structure
>pdb|1U35|D Chain D, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 126 Back     alignment and structure
>pdb|1EQZ|B Chain B, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 126 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|2HIO|B Chain B, Histone Octamer (Chicken), Chromosomal Protein Length = 125 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|3A6N|D Chain D, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 129 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|2CV5|D Chain D, Crystal Structure Of Human Nucleosome Core Particle Length = 126 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|2XQL|B Chain B, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 90 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|3AN2|D Chain D, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 129 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|1HIO|B Chain B, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 90 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|1ID3|D Chain D, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 130 Back     alignment and structure
>pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 Back     alignment and structure
>pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 Back     alignment and structure
>pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure
>pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 Back     alignment and structure
>pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 Back     alignment and structure
>pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 Back     alignment and structure
>pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 Back     alignment and structure
>pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 Back     alignment and structure
>pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 Back     alignment and structure
>pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 Back     alignment and structure
>pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 Back     alignment and structure
>pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 Back     alignment and structure
>pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 Back     alignment and structure
>pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 Back     alignment and structure
>pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 Back     alignment and structure
>pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 Back     alignment and structure
>pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 Back     alignment and structure
>pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 Back     alignment and structure
>pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 Back     alignment and structure
>pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 Back     alignment and structure
>pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 Back     alignment and structure
>pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 Back     alignment and structure
>pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query581
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 2e-58
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 1e-55
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 7e-50
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 1e-47
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 6e-47
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 6e-47
3r45_A156 Histone H3-like centromeric protein A; histone fol 1e-46
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 7e-46
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 7e-46
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 1e-43
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 2e-42
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 1e-40
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 6e-37
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 4e-35
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 2e-31
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 1e-26
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 4e-30
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 1e-07
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 4e-05
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 1e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 5e-09
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 3e-08
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 3e-07
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 1e-05
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 2e-04
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 6e-04
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 6e-04
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 Back     alignment and structure
 Score =  190 bits (483), Expect = 2e-58
 Identities = 136/136 (100%), Positives = 136/136 (100%)

Query: 446 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 505
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 506 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 565
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 566 MPKDIQLARRIRGERA 581
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Length = 123 Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Length = 126 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure
>2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 Back     alignment and structure
>3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Length = 70 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query581
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 100.0
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 100.0
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 100.0
3r45_A156 Histone H3-like centromeric protein A; histone fol 100.0
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 100.0
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 100.0
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 100.0
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 100.0
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 100.0
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 100.0
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 100.0
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 100.0
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 99.97
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 99.97
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 99.97
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 99.97
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 99.96
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 99.87
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.85
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.73
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.63
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.5
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.47
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.45
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.44
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.37
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 99.32
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 99.32
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.18
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.08
1f1e_A154 Histone fold protein; archaeal histone protein, DN 98.78
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 98.49
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 98.49
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 98.18
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 98.12
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 98.11
2r10_A 361 Chromatin structure-remodeling complex protein RSC 98.04
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 98.02
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 97.99
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 97.94
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 97.83
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 97.78
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 97.68
1taf_A68 TFIID TBP associated factor 42; transcription init 97.47
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 97.46
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 97.35
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 97.33
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 97.25
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 97.25
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 97.23
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 97.2
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 97.12
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 97.11
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 97.09
1taf_B70 TFIID TBP associated factor 62; transcription init 97.06
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 96.93
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 96.4
1taf_B70 TFIID TBP associated factor 62; transcription init 96.29
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 96.13
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 96.04
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 95.98
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 95.8
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 95.51
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 95.46
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 95.37
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 95.34
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 95.29
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 95.1
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 95.07
1taf_A68 TFIID TBP associated factor 42; transcription init 95.04
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 94.44
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 94.21
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 94.01
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 93.89
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 93.68
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 93.13
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 92.72
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 92.12
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 89.76
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 89.76
3r45_A156 Histone H3-like centromeric protein A; histone fol 88.32
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 87.89
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 86.49
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 86.31
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 86.02
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 82.34
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 81.59
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 80.94
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
Probab=100.00  E-value=3.3e-53  Score=389.54  Aligned_cols=136  Identities=100%  Similarity=1.353  Sum_probs=93.8

Q ss_pred             CccccccccCCCCCCCCccchhhhhhcccCCCCCCCCCCccCCCCcchhhhhhhcccchhhhhccCchhHHHHHHHhhcc
Q psy3827         446 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK  525 (581)
Q Consensus       446 MARtKqtArkstggkaPrK~la~k~arks~p~~~~~kk~~r~rpgt~alrEIR~yQkst~lLI~K~pF~RLVrEI~~~~~  525 (581)
                      ||||||+|++++||++|+|++++++++|++|..++.++|||||||++||+|||+||+||+|||||+||+||||||+++|.
T Consensus         1 MARtk~tarkstggkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~~~~~   80 (136)
T 1tzy_C            1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_dssp             -----------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHC
T ss_pred             CCCCccccccCCCCCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHhhhhccchhhhhhhhcCCeeeeCcccHHHHHHHhccCC
Q psy3827         526 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  581 (581)
Q Consensus       526 ~~~Rfq~~Al~aLQeAaEayLv~lFEda~lcA~HaKRVTI~~kDiqLa~rIrg~~~  581 (581)
                      +++|||++||.|||||+|+|||+||||+|+||+||||||||++|||||+||||+++
T Consensus        81 ~~~R~q~~Al~aLQeaaEayLv~Lfeda~l~A~HAkRvTi~~kDiqLa~rirg~~~  136 (136)
T 1tzy_C           81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  136 (136)
T ss_dssp             TTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHHHTCCC
T ss_pred             hhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCcHHhHHHHHHHhCcCC
Confidence            99999999999999999999999999999999999999999999999999999874
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 581
d1tzyc_95 a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), 2e-61
d1tzyb_92 a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus) 3e-58
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 3e-56
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 3e-54
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 4e-47
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 1e-42
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 1e-21
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 1e-04
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 2e-22
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 7e-04
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 1e-20
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 3e-13
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 3e-10
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 7e-10
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 9e-05
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 1e-19
d1ku5a_66 a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc 9e-06
d1htaa_68 a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth 8e-05
d1n1ja_87 a.22.1.3 (A:) Nuclear transcription factor Y subun 4e-04
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

 Score =  195 bits (498), Expect = 2e-61
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 487 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 546
           YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL
Sbjct: 1   YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 60

Query: 547 VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 581
           VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 61  VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 95
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 92 Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query581
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 100.0
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 100.0
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 100.0
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 100.0
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 100.0
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.9
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.89
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.75
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.29
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.23
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 98.9
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 98.34
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 98.33
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 98.2
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 97.98
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 97.97
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 97.79
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 97.6
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 97.32
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 97.18
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 97.15
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 97.03
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 96.85
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 96.68
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 96.61
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 96.2
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 96.02
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 94.88
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 94.67
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 94.33
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 94.25
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 90.2
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 89.36
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 88.36
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 87.13
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 84.96
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2B
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

Probab=100.00  E-value=2.6e-47  Score=327.50  Aligned_cols=92  Identities=93%  Similarity=1.267  Sum_probs=90.5

Q ss_pred             cccceeEeeeeecccccCCCCcchhhHHHHHHHHHHHHHHHHHHHhhhhhccCCcccchhHHHHHHHhhCchHHhhhhhh
Q psy3827         238 RKESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS  317 (581)
Q Consensus       238 r~esy~~YiykVLKQVhpd~gISskam~imnsfvnDiferIA~EAs~La~~nkr~TitsreIqtAvrLlLPgeLaKhAvs  317 (581)
                      |+|+|++||||||||||||+|||++||+||||||||||||||.||++|++||||+|||+||||+||||+||||||||||+
T Consensus         1 R~esy~~Yi~kVLKqVhp~~giS~kam~imnsfvndiferIa~EA~~La~~~kr~TitsreIqtAvrL~LPgeLaKhAvs   80 (92)
T d1tzyb_           1 RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS   80 (92)
T ss_dssp             CCCCCHHHHHHHHHHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHHHSCHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhhCCCCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCcHHHHHHHHHHHCcHHHHHHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcchhhccccc
Q psy3827         318 EGTKAVTKYTSS  329 (581)
Q Consensus       318 eGtkAVtky~ss  329 (581)
                      ||||||+||++|
T Consensus        81 eGtkAv~ky~ss   92 (92)
T d1tzyb_          81 EGTKAVTKYTSS   92 (92)
T ss_dssp             HHHHHHHHHHHC
T ss_pred             HHHHHHHHhccC
Confidence            999999999975
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure