Diaphorina citri psyllid: psy3840


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MQSSRNNGSFLATGSYDGYARIWTSDGSLKSTLGQHKGPIFALKWNKRGNYILSAGVDKTTIIWDAASGQCEQQFSFHSAPALDVDWQSNTSFASCSTDQHIHVCKLHSDKPVKSFEGHTRVYYLAMDLLF
cccccccccEEEEccccccEEEEcccccEEEEcccccccEEEEEEcccccEEEECcccccEEEEEccccCEEEEcccccccEEEEEEcccccEEEccccccEEEEEccccCEEEEECccccEEEEEEEEEc
*QSSRNNGSFLATGSYDGYARIWTSDGSLKSTLGQHKGPIFALKWNKRGNYILSAGVDKTTIIWDAASGQCEQQFSFHSAPALDVDWQSNTSFASCSTDQHIHVCKLHSDKPVKSFEGHTRVYYLAMDLLF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSSRNNGSFLATGSYDGYARIWTSDGSLKSTLGQHKGPIFALKWNKRGNYILSAGVDKTTIIWDAASGQCEQQFSFHSAPALDVDWQSNTSFASCSTDQHIHVCKLHSDKPVKSFEGHTRVYYLAMDLLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box-like/WD repeat-containing protein TBL1X F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.confidentO60907
F-box-like/WD repeat-containing protein ebi F-box-like component of E3 ubiquitin ligase complexes; involved in R7 photoreceptor cell differentiation, cone cell development and neuronal cell cycle control. E3 ubiquitin ligase complexes mediate ubiquitination and subsequent proteasomal degradation of target proteins. Required for specification of R7 photoreceptor cell fate in the eye by participating in the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk), a general inhibitor of photoreceptor differentiation. Required to block the S phase entry in the peripheral nervous system and central nervous system in a process that does not involve the degradation of ttk. Involved in cone cell development by preventing the transcriptional repression mediated by Su(H) on Dl, probably by participating in a E3 complex that contains sno and mediates the ubiquitination and subsequent proteasomal degradation of some component of the Su(H) repressor complex.confidentQ95RJ9
F-box-like/WD repeat-containing protein TBL1X F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.confidentQ9QXE7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingconfidentGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0080090 [BP]regulation of primary metabolic processconfidentGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010604 [BP]positive regulation of macromolecule metabolic processconfidentGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0043234 [CC]protein complexconfidentGO:0005575, GO:0032991
GO:0043232 [CC]intracellular non-membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044451 [CC]nucleoplasm partconfidentGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0031325 [BP]positive regulation of cellular metabolic processconfidentGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0000118 [CC]histone deacetylase complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0031065 [BP]positive regulation of histone deacetylationprobableGO:0033044, GO:0009893, GO:0019222, GO:0033043, GO:0031325, GO:0031323, GO:0051128, GO:0031056, GO:0031058, GO:0050789, GO:0080090, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0051130, GO:0060255, GO:0090312, GO:0090311, GO:0050794, GO:0008150, GO:0031063, GO:0032268, GO:0031401, GO:0010638, GO:2001252, GO:0048522
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0008013 [MF]beta-catenin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044255 [BP]cellular lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0045444 [BP]fat cell differentiationprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0022416 [BP]chaeta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043627 [BP]response to estrogen stimulusprobableGO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0007173 [BP]epidermal growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0016570 [BP]histone modificationprobableGO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0016043, GO:0071704, GO:0071840, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0001106 [MF]RNA polymerase II transcription corepressor activityprobableGO:0001191, GO:0003714, GO:0003712, GO:0001104, GO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0030162 [BP]regulation of proteolysisprobableGO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:0070491 [MF]repressing transcription factor bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0042461 [BP]photoreceptor cell developmentprobableGO:0048666, GO:0044767, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0046530, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0032502, GO:0007275, GO:0044699, GO:0044707
GO:0042676 [BP]compound eye cone cell fate commitmentprobableGO:0048749, GO:0030154, GO:0009653, GO:0007275, GO:0044699, GO:0001745, GO:0048869, GO:0008150, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0048592, GO:0009987, GO:0044767, GO:0042675, GO:0001654, GO:0048731, GO:0045165, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0042058 [BP]regulation of epidermal growth factor receptor signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:1901184, GO:0010646, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 3-126
View the alignment between query and template
View the model in PyMOL