Diaphorina citri psyllid: psy3867

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-
MGSKWLTQIYVECMTVLSESSLIVVNVMDPHPRACSKEQVLNGDEEITQNIRVVFSFSRADKLCPRCNTNNGEVVLRLKDIYCKACLLQYLNHKFRAALGKSKMMRPQDKVLVAFSGSHSSMALLHLLQEGMQLSSHKRILFSVCAIYIDDGSISQVSISERKANNAQIATAMKYFDSYFTCLEQALEPDNMKLYTDVAELPLEQFAKDSEINKMFQTVTTLSSRQYLLQTLRQNLLLQAAKKLNCTKIFTAETQTDLATKIIANISLGKGAHVPLDVGFSDDRTGDIITLRPLRDFSSKEVIYYNIFNDLSPVHVPSLATLADPLASLQKAAESFVTDLQTNFPSTVSTVFRTADKLSLDLTSMNVNNTCLLCKAPLDTRADLASSSMGATRFSRYVSNATREQLSHVIISSESPDHASKVTTDVNQTVGSQDIPEKSVNGSEDIPNQIVNGMQYTPNEKVSRTEDNEGPDNLQRSLCYACQYVVKDMTSDKDIGEGILKKCLQEKSLNEMEDQIRDFLL
ccccHHHHHHHHHHHHccccccEEEEECccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccccEEEccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHccccccccccccccccccccEEEECccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
***KWLTQIYVECMTVLSESSLIVVNVMDPHPRACSKEQVLNGDEEITQNIRVVFSFSRADKLCPRCNTNNGEVVLRLKDIYCKACLLQYLNHKFRAALGKSKMMRPQDKVLVAFSGSHSSMALLHLLQEGMQLSSHKRILFSVCAIYIDDGSISQVSISERKANNAQIATAMKYFDSYFTCLEQALEPDNMKLYTDVAELPLEQFAKDSEINKMFQTVTTLSSRQYLLQTLRQNLLLQAAKKLNCTKIFTAETQTDLATKIIANISLGKGAHVPLDVGFSDDRTGDIITLRPLRDFSSKEVIYYNIFNDLSPVHVPSLATLADPLASLQKAAESFVTDLQTNFPSTVSTVFRTADKLSLD*****VNNTCLLCKAPLDTRAD*****************************************************************************************NLQRSLCYACQYVVKDMTSDKDIGEGILKKCL**********QIRDFLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSKWLTQIYVECMTVLSESSLIVVNVMDPHPRACSKEQVLNGDEEITQNIRVVFSFSRADKLCPRCNTNNGEVVLRLKDIYCKACLLQYLNHKFRAALGKSKMMRPQDKVLVAFSGSHSSMALLHLLQEGMQLSSHKRILFSVCAIYIDDGSISQVSISERKANNAQIATAMKYFDSYFTCLEQALEPDNMKLYTDVAELPLEQFAKDSEINKMFQTVTTLSSRQYLLQTLRQNLLLQAAKKLNCTKIFTAETQTDLATKIIANISLGKGAHVPLDVGFSDDRTGDIITLRPLRDFSSKEVIYYNIFNDLSPVHVPSLATLADPLASLQKAAESFVTDLQTNFPSTVSTVFRTADKLSLDLTSMNVNNTCLLCKAPLDTRADLASSSMGATRFSRYVSNATREQLSHVIISSESPDHASKVTTDVNQTVGSQDIPEKSVNGSEDIPNQIVNGMQYTPNEKVSRTEDNEGPDNLQRSLCYACQYVVKDMTSDKDIGEGILKKCLQEKSLNEMEDQIRDFLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytoplasmic tRNA 2-thiolation protein 2 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with ctu1/atpbd3 that ligates sulfur from thiocarboxylated urm1 onto the uridine of tRNAs at wobble position.confidentQ6DC53
Cytoplasmic tRNA 2-thiolation protein 2 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with atpbd3/ncs6 that ligates sulfur from thiocarboxylated urm1 onto the uridine of tRNAs at wobble position.confidentQ28ES8
Cytoplasmic tRNA 2-thiolation protein 2 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with CTU1/ATPBD3 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.confidentQ2VPK5

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WY5, chain A
Confidence level:confident
Coverage over the Query: 86-199,222-361
View the alignment between query and template
View the model in PyMOL
Template: 2DER, chain A
Confidence level:confident
Coverage over the Query: 125-198,220-312,332-347
View the alignment between query and template
View the model in PyMOL
Template: 2WSI, chain A
Confidence level:confident
Coverage over the Query: 63-183,201-212,225-313
View the alignment between query and template
View the model in PyMOL
Template: 3K1F, chain M
Confidence level:probable
Coverage over the Query: 46-86
View the alignment between query and template
View the model in PyMOL