Diaphorina citri psyllid: psy3868

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------7

MSYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKREL

cHHHHHHHHHHHHccEEEEEEccHHHccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccc

*SYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIA*KR*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKREL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cell division control protein 48 homolog A	Probably functions in cell division and growth processes. Interacts with certain SNAREs as part of specialized membrane fusion events where vesicles from the same organelle fuse (homotypic fusion).	very confident	P54609
Transitional endoplasmic reticulum ATPase	Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). Component of the VCP/p97-AMFR/gp78 complex that participates in the final step of the sterol-mediated ubiquitination and endoplasmic reticulum-associated degradation (ERAD) of HMGCR.	very confident	P46462
Transitional endoplasmic reticulum ATPase	Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). Component of the VCP/p97-AMFR/gp78 complex that participates in the final step of the sterol-mediated ubiquitination and endoplasmic reticulum-associated degradation (ERAD) of HMGCR.	very confident	Q3ZBT1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005794 [CC]	Golgi apparatus	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0022626 [CC]	cytosolic ribosome	confident	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0034214 [BP]	protein hexamerization	confident	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005654 [CC]	nucleoplasm	confident	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006302 [BP]	double-strand break repair	confident	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0035861 [CC]	site of double-strand break	confident	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005875 [CC]	microtubule associated complex	confident	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0009524 [CC]	phragmoplast	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048856 [BP]	anatomical structure development	confident	GO:0032502, GO:0008150
GO:0031593 [MF]	polyubiquitin binding	confident	GO:0003674, GO:0043130, GO:0032182, GO:0005488, GO:0005515
GO:0016192 [BP]	vesicle-mediated transport	confident	GO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0000790 [CC]	nuclear chromatin	confident	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0006919 [BP]	activation of cysteine-type endopeptidase activity involved in apoptotic process	confident	GO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0097202, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0043280, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0006200 [BP]	ATP catabolic process	confident	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0032403 [MF]	protein complex binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0005102 [MF]	receptor binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0048046 [CC]	apoplast	confident	GO:0005575, GO:0005576
GO:0005819 [CC]	spindle	confident	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005811 [CC]	lipid particle	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030433 [BP]	ER-associated protein catabolic process	confident	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0042221 [BP]	response to chemical stimulus	confident	GO:0050896, GO:0008150
GO:0032436 [BP]	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	confident	GO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0005783 [CC]	endoplasmic reticulum	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016887 [MF]	ATPase activity	confident	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0030970 [BP]	retrograde protein transport, ER to cytosol	confident	GO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0042802 [MF]	identical protein binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0009986 [CC]	cell surface	confident	GO:0005575, GO:0044464, GO:0005623
GO:0009506 [CC]	plasmodesma	confident	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0000502 [CC]	proteasome complex	confident	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005618 [CC]	cell wall	confident	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005635 [CC]	nuclear envelope	confident	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051260 [BP]	protein homooligomerization	confident	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0031334 [BP]	positive regulation of protein complex assembly	confident	GO:0051130, GO:0051128, GO:0044087, GO:0065007, GO:0048518, GO:0008150, GO:0043254, GO:0050794, GO:0050789, GO:0048522
GO:0006906 [BP]	vesicle fusion	probable	GO:0006996, GO:0009987, GO:0016192, GO:0008150, GO:0016044, GO:0071840, GO:0006810, GO:0016050, GO:0061025, GO:0061024, GO:0048284, GO:0006944, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0016043
GO:0034517 [BP]	ribophagy	probable	GO:0006914, GO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0043332 [CC]	mating projection tip	probable	GO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0051228 [BP]	mitotic spindle disassembly	probable	GO:0006996, GO:0032984, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0044699, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0007052, GO:0000226, GO:0022411, GO:0022402, GO:0043241, GO:0007049, GO:0051230
GO:0061166 [BP]	establishment of endoplasmic reticulum localization involved in endoplasmic reticulum polarization at cell division site	probable	GO:0006996, GO:0051234, GO:0007029, GO:0071840, GO:0009987, GO:0016043, GO:0051179, GO:0008150, GO:0007163, GO:0044763, GO:0044699, GO:0051641, GO:0051649, GO:0061164, GO:0061165, GO:0051656, GO:0051686, GO:0051643, GO:0051640, GO:0061163
GO:0006888 [BP]	ER to Golgi vesicle-mediated transport	probable	GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0009860 [BP]	pollen tube growth	probable	GO:0048610, GO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0009653, GO:0044699, GO:0009826, GO:0000904, GO:0016049, GO:0000003, GO:0048868, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0051704, GO:0060560, GO:0000902, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0040007, GO:0048856, GO:0044703, GO:0003006, GO:0044706, GO:0009932, GO:0009856, GO:0044763
GO:0072671 [BP]	mitochondria-associated protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0097308 [BP]	cellular response to farnesol	probable	GO:1901700, GO:1901701, GO:0051716, GO:0033993, GO:0050896, GO:0009987, GO:0071396, GO:0008150, GO:0071310, GO:0044763, GO:0044699, GO:0070887, GO:0042221, GO:0097305, GO:0010033, GO:0097307, GO:0097306
GO:0048813 [BP]	dendrite morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0016320 [BP]	endoplasmic reticulum membrane fusion	probable	GO:0006996, GO:0090174, GO:0016044, GO:0071840, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0048284, GO:0006944, GO:0008150, GO:0044763, GO:0044699
GO:0008289 [MF]	lipid binding	probable	GO:0003674, GO:0005488
GO:0031134 [BP]	sister chromatid biorientation	probable	GO:0033036, GO:0008104, GO:0008608, GO:0000226, GO:0007067, GO:0051656, GO:0051303, GO:0044699, GO:0032507, GO:0070727, GO:0051651, GO:0071840, GO:0000280, GO:0016043, GO:0051179, GO:0008150, GO:0007080, GO:0065007, GO:0007049, GO:0065008, GO:0007010, GO:0034453, GO:0034613, GO:0000278, GO:0009987, GO:0045185, GO:0007017, GO:0044763, GO:0051649, GO:0051310, GO:0007059, GO:0051235, GO:0051234, GO:0051315, GO:0051640, GO:0051641, GO:0006996, GO:0000070, GO:0000819, GO:0051276, GO:0050000, GO:0048285, GO:0022402
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0046686 [BP]	response to cadmium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0034727 [BP]	piecemeal microautophagy of nucleus	probable	GO:0016044, GO:0006914, GO:0009987, GO:0016237, GO:0010324, GO:0044248, GO:0061024, GO:0044763, GO:0044237, GO:0008152, GO:0071840, GO:0008150, GO:0009056, GO:0044699, GO:0016043
GO:0008103 [BP]	oocyte microtubule cytoskeleton polarization	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0007163, GO:0000226, GO:0007309, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0030952, GO:0030951, GO:0048869, GO:0071840, GO:0016043, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0016325, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044702, GO:0044763, GO:0022412, GO:0000003, GO:0006996, GO:0044767, GO:0007017, GO:0007010, GO:0044707, GO:0003006, GO:0048856, GO:0008150
GO:0043523 [BP]	regulation of neuron apoptotic process	probable	GO:0050794, GO:0043067, GO:0065007, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0050789
GO:2000058 [BP]	regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	probable	GO:0009894, GO:0032268, GO:0080090, GO:0031329, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0008150, GO:0042176, GO:0030162, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0050789
GO:0070842 [BP]	aggresome assembly	probable	GO:0022607, GO:0070841, GO:0016043, GO:0044085, GO:0008150, GO:0071840
GO:0019985 [BP]	translesion synthesis	probable	GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901362, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0018130, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0044238, GO:0044271, GO:0006301, GO:0050896, GO:0044763, GO:0006950, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0019438, GO:0071897
GO:0016567 [BP]	protein ubiquitination	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0007317 [BP]	regulation of pole plasm oskar mRNA localization	probable	GO:2000241, GO:0051239, GO:0060341, GO:0050793, GO:0060281, GO:0060284, GO:0050794, GO:0008150, GO:0044087, GO:0045595, GO:2000026, GO:0045995, GO:0065007, GO:0032879, GO:0051128, GO:0050789
GO:0000837 [CC]	Doa10p ubiquitin ligase complex	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0012505, GO:0043234, GO:0000835, GO:0032991, GO:0043231, GO:0044464, GO:0000151, GO:0005623, GO:0000153, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0033047 [BP]	regulation of mitotic sister chromatid segregation	probable	GO:0033044, GO:0033045, GO:0007346, GO:0033043, GO:0051726, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0007088, GO:0050789, GO:0051983
GO:0071470 [BP]	cellular response to osmotic stress	probable	GO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0006970, GO:0033554, GO:0044763, GO:0071214, GO:0044699
GO:0034098 [CC]	Cdc48p-Npl4p-Ufd1p AAA ATPase complex	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0071712 [BP]	ER-associated misfolded protein catabolic process	probable	GO:0044248, GO:0070887, GO:0043632, GO:0044699, GO:0044267, GO:0051716, GO:0044265, GO:0044260, GO:0043161, GO:0009057, GO:0071704, GO:0071310, GO:0035966, GO:0071218, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:1901575, GO:0006950, GO:0044763, GO:0030163, GO:0008152, GO:0030433, GO:0044257, GO:0042221, GO:0009056, GO:0010033, GO:0051603, GO:0019538, GO:0050896, GO:0010498, GO:0044237, GO:0043170, GO:0035967, GO:0006511, GO:0033554, GO:0006515, GO:0008150, GO:0051788
GO:0016236 [BP]	macroautophagy	probable	GO:0009991, GO:0008152, GO:0044248, GO:0042594, GO:0044699, GO:0051716, GO:0071496, GO:0006914, GO:0009987, GO:0006950, GO:0008150, GO:0009267, GO:0007154, GO:0009056, GO:0031668, GO:0031669, GO:0009605, GO:0050896, GO:0031667, GO:0044237, GO:0033554, GO:0044763
GO:0043581 [BP]	mycelium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0018279 [BP]	protein N-linked glycosylation via asparagine	probable	GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0006487, GO:0018196, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0009846 [BP]	pollen germination	probable	GO:0044703, GO:0032501, GO:0000003, GO:0044707, GO:0044706, GO:0022414, GO:0009856, GO:0008150, GO:0044699, GO:0051704
GO:0019903 [MF]	protein phosphatase binding	probable	GO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0019904 [MF]	protein domain specific binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0043531 [MF]	ADP binding	probable	GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:1900182 [BP]	positive regulation of protein localization to nucleus	probable	GO:1900180, GO:0032879, GO:0060341, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0048522, GO:0050789, GO:0032880
GO:0016235 [CC]	aggresome	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0016234, GO:0044424
GO:0042052 [BP]	rhabdomere development	probable	GO:0048666, GO:0044707, GO:0042051, GO:0030154, GO:0048468, GO:0001745, GO:0007275, GO:0071840, GO:0042462, GO:0042461, GO:0009653, GO:0048869, GO:0016043, GO:0048513, GO:0044699, GO:0048749, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0006996, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150, GO:0032502
GO:0071630 [BP]	nucleus-associated proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0070887, GO:0043632, GO:0044699, GO:0044267, GO:0051716, GO:0044265, GO:0044260, GO:0043161, GO:0009057, GO:0071704, GO:0071310, GO:0006511, GO:0071218, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:1901575, GO:0006950, GO:0044763, GO:0030163, GO:0008152, GO:0044257, GO:0042221, GO:0009056, GO:0010033, GO:0051603, GO:0019538, GO:0050896, GO:0010498, GO:0044237, GO:0043170, GO:0035967, GO:0035966, GO:0033554, GO:0006515, GO:0008150, GO:0051788
GO:0035101 [CC]	FACT complex	probable	GO:0008023, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0071629 [BP]	cytoplasm-associated proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0070887, GO:0043632, GO:0044699, GO:0044267, GO:0051716, GO:0044265, GO:0044260, GO:0043161, GO:0009057, GO:0071704, GO:0071310, GO:0006511, GO:0071218, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:1901575, GO:0006950, GO:0044763, GO:0030163, GO:0008152, GO:0044257, GO:0042221, GO:0009056, GO:0010033, GO:0051603, GO:0019538, GO:0050896, GO:0010498, GO:0044237, GO:0043170, GO:0035967, GO:0035966, GO:0033554, GO:0006515, GO:0008150, GO:0051788
GO:0030968 [BP]	endoplasmic reticulum unfolded protein response	probable	GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0006984, GO:0051716, GO:0006986, GO:0071310, GO:0065007, GO:0009987, GO:0050794, GO:0006950, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0050896, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0034976, GO:0034620
GO:0036266 [CC]	Cdc48p-Npl4p-Vms1p AAA ATPase complex	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031968, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0005741, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0045451 [BP]	pole plasm oskar mRNA localization	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0022607, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0008298, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0044702, GO:0048856, GO:0044085, GO:0048869, GO:0044763, GO:0009987
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0007126 [BP]	meiosis	probable	GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0040018 [BP]	positive regulation of multicellular organism growth	probable	GO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005777 [CC]	peroxisome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008540 [CC]	proteasome regulatory particle, base subcomplex	probable	GO:0043234, GO:0005838, GO:0022624, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0000502, GO:0044424, GO:0032991
GO:0000910 [BP]	cytokinesis	probable	GO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0042742 [BP]	defense response to bacterium	probable	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0016310 [BP]	phosphorylation	probable	GO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0040002 [BP]	collagen and cuticulin-based cuticle development	probable	GO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 3-66
View the alignment between query and template
View the model in PyMOL