Psyllid ID: psy3868


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------7
MSYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKREL
cHHHHHHHHHHHHccEEEEEEccHHHccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccc
ccHHHHHHHHHHcccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEcHHHHccccccccc
MSYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEeadknspsiifideldaiapkrekrel
msyrlttlcrdSLGAFFFLINGPEIMSKLAGESESNLRKAFEeadknspsiifideldaiapkrekrel
MSYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKREL
***RLTTLCRDSLGAFFFLINGPEIM************************IIFIDEL************
*SYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIA*KR*****
MSYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKREL
*SYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPK******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKREL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query69 2.2.26 [Sep-21-2011]
P23787 805 Transitional endoplasmic N/A N/A 0.768 0.065 0.943 2e-22
Q01853 806 Transitional endoplasmic yes N/A 0.768 0.065 0.943 2e-22
P55072 806 Transitional endoplasmic yes N/A 0.768 0.065 0.943 2e-22
P46462 806 Transitional endoplasmic yes N/A 0.768 0.065 0.943 2e-22
Q3ZBT1 806 Transitional endoplasmic yes N/A 0.768 0.065 0.943 2e-22
Q6GL04 805 Transitional endoplasmic yes N/A 0.768 0.065 0.943 2e-22
P03974 806 Transitional endoplasmic yes N/A 0.768 0.065 0.943 2e-22
Q7ZU99 806 Transitional endoplasmic no N/A 0.768 0.065 0.943 2e-22
Q9P3A7 815 Cell division cycle prote yes N/A 0.768 0.065 0.905 4e-22
Q7KN62 801 Transitional endoplasmic yes N/A 0.768 0.066 0.924 4e-22
>sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 Back     alignment and function desciption
 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/53 (94%), Positives = 53/53 (100%)

Query: 14  GAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK 66
           GAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIFIDELDAIAPKREK
Sbjct: 263 GAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREK 315




Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the nuclear envelope, and of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process.
Xenopus laevis (taxid: 8355)
>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 Back     alignment and function description
>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 Back     alignment and function description
>sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 Back     alignment and function description
>sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 Back     alignment and function description
>sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 Back     alignment and function description
>sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 Back     alignment and function description
>sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 Back     alignment and function description
>sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 Back     alignment and function description
>sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
357623246 1316 transitional endoplasmic reticulum ATPas 0.768 0.040 0.981 7e-22
112983322 805 transitional endoplasmic reticulum ATPas 0.768 0.065 0.981 1e-21
242008814 804 conserved hypothetical protein [Pediculu 0.768 0.065 0.981 1e-21
91086235 803 PREDICTED: similar to transitional endop 0.768 0.066 0.981 1e-21
344251788 2171 Transitional endoplasmic reticulum ATPas 0.768 0.024 0.943 1e-21
193617621 804 PREDICTED: transitional endoplasmic reti 0.768 0.065 0.962 2e-21
443694341 812 hypothetical protein CAPTEDRAFT_161400, 0.768 0.065 0.962 3e-21
380016377 893 PREDICTED: LOW QUALITY PROTEIN: transiti 0.768 0.059 0.962 3e-21
383861759 811 PREDICTED: transitional endoplasmic reti 0.768 0.065 0.962 3e-21
307211146 796 Transitional endoplasmic reticulum ATPas 0.768 0.066 0.962 4e-21
>gi|357623246|gb|EHJ74479.1| transitional endoplasmic reticulum ATPase TER94 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%)

Query: 14  GAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK 66
           GAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSP+IIFIDELDAIAPKREK
Sbjct: 772 GAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPAIIFIDELDAIAPKREK 824




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|112983322|ref|NP_001037003.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] gi|83423461|dbj|BAE54254.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] gi|95102992|gb|ABF51437.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] Back     alignment and taxonomy information
>gi|242008814|ref|XP_002425193.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508909|gb|EEB12455.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91086235|ref|XP_966692.1| PREDICTED: similar to transitional endoplasmic reticulum ATPase TER94 isoform 1 [Tribolium castaneum] gi|270011017|gb|EFA07465.1| transitional endoplasmic reticulum ATPase TER94 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|344251788|gb|EGW07892.1| Transitional endoplasmic reticulum ATPase [Cricetulus griseus] Back     alignment and taxonomy information
>gi|193617621|ref|XP_001949588.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|443694341|gb|ELT95504.1| hypothetical protein CAPTEDRAFT_161400, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|380016377|ref|XP_003692162.1| PREDICTED: LOW QUALITY PROTEIN: transitional endoplasmic reticulum ATPase TER94-like [Apis florea] Back     alignment and taxonomy information
>gi|383861759|ref|XP_003706352.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307211146|gb|EFN87364.1| Transitional endoplasmic reticulum ATPase TER94 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
UNIPROTKB|P23787 805 vcp "Transitional endoplasmic 0.768 0.065 0.943 1.2e-20
UNIPROTKB|Q6GL04 805 vcp "Transitional endoplasmic 0.768 0.065 0.943 1.2e-20
ZFIN|ZDB-GENE-060312-22 805 zgc:136908 "zgc:136908" [Danio 0.768 0.065 0.943 1.2e-20
UNIPROTKB|G3X757 806 VCP "Transitional endoplasmic 0.768 0.065 0.943 1.2e-20
UNIPROTKB|Q3ZBT1 806 VCP "Transitional endoplasmic 0.768 0.065 0.943 1.2e-20
UNIPROTKB|P55072 806 VCP "Transitional endoplasmic 0.768 0.065 0.943 1.2e-20
UNIPROTKB|P03974 806 VCP "Transitional endoplasmic 0.768 0.065 0.943 1.2e-20
MGI|MGI:99919 806 Vcp "valosin containing protei 0.768 0.065 0.943 1.2e-20
RGD|621595 806 Vcp "valosin-containing protei 0.768 0.065 0.943 1.2e-20
ZFIN|ZDB-GENE-030131-5408 806 vcp "valosin containing protei 0.768 0.065 0.943 1.2e-20
UNIPROTKB|P23787 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 254 (94.5 bits), Expect = 1.2e-20, P = 1.2e-20
 Identities = 50/53 (94%), Positives = 53/53 (100%)

Query:    14 GAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK 66
             GAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIFIDELDAIAPKREK
Sbjct:   263 GAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREK 315


GO:0000785 "chromatin" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0006200 "ATP catabolic process" evidence=IDA
GO:0006302 "double-strand break repair" evidence=ISS
GO:0006974 "response to DNA damage stimulus" evidence=ISS
GO:0016567 "protein ubiquitination" evidence=ISS
GO:0016887 "ATPase activity" evidence=IDA
GO:0018279 "protein N-linked glycosylation via asparagine" evidence=ISS
GO:0019985 "translesion synthesis" evidence=ISS
GO:0030433 "ER-associated protein catabolic process" evidence=ISS
GO:0032403 "protein complex binding" evidence=IPI
GO:0034214 "protein hexamerization" evidence=IDA
GO:0035861 "site of double-strand break" evidence=ISS
GO:0035101 "FACT complex" evidence=IPI
UNIPROTKB|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060312-22 zgc:136908 "zgc:136908" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBT1 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P03974 VCP "Transitional endoplasmic reticulum ATPase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:99919 Vcp "valosin containing protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621595 Vcp "valosin-containing protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q07590SAV_SULACNo assigned EC number0.61900.86950.0769yesN/A
Q58556Y1156_METJANo assigned EC number0.65570.88400.0675yesN/A
P54609CD48A_ARATHNo assigned EC number0.90560.76810.0655yesN/A
Q9SCN8CD48D_ARATHNo assigned EC number0.90560.76810.0650noN/A
P46462TERA_RATNo assigned EC number0.94330.76810.0657yesN/A
Q3ZBT1TERA_BOVINNo assigned EC number0.94330.76810.0657yesN/A
Q9P3A7CDC48_SCHPONo assigned EC number0.90560.76810.0650yesN/A
P55072TERA_HUMANNo assigned EC number0.94330.76810.0657yesN/A
Q01853TERA_MOUSENo assigned EC number0.94330.76810.0657yesN/A
Q5AWS6CDC48_EMENINo assigned EC number0.90560.76810.0643yesN/A
Q8SSJ5CDC48_ENCCUNo assigned EC number0.85450.73910.0653yesN/A
Q7KN62TERA_DROMENo assigned EC number0.92450.76810.0661yesN/A
Q96372CDC48_CAPANNo assigned EC number0.90560.76810.0658N/AN/A
P54812TERA2_CAEELNo assigned EC number0.84900.76810.0654yesN/A
Q7ZU99TERA_DANRENo assigned EC number0.94330.76810.0657noN/A
Q6GL04TERA_XENTRNo assigned EC number0.94330.76810.0658yesN/A
O05209VAT_THEACNo assigned EC number0.64150.76810.0711yesN/A
P54774CDC48_SOYBNNo assigned EC number0.90560.76810.0656noN/A
P25694CDC48_YEASTNo assigned EC number0.84900.76810.0634yesN/A
P23787TERA_XENLANo assigned EC number0.94330.76810.0658N/AN/A
Q9LZF6CD48E_ARATHNo assigned EC number0.90560.76810.0654yesN/A
P03974TERA_PIGNo assigned EC number0.94330.76810.0657yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-23
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-19
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-15
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 4e-14
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-12
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 7e-11
COG1223 368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 1e-09
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-09
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-09
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-09
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 3e-09
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 5e-09
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 5e-08
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 5e-08
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 3e-07
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 5e-06
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-05
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-04
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
 Score = 90.0 bits (223), Expect = 4e-23
 Identities = 38/53 (71%), Positives = 46/53 (86%)

Query: 14  GAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK 66
           GA+F  INGPEIMSK  GESE  LR+ F+EA++N+PSIIFIDE+DAIAPKRE+
Sbjct: 237 GAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREE 289


This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733

>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 69
KOG0733|consensus 802 99.89
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.87
KOG0739|consensus 439 99.87
KOG0738|consensus 491 99.86
KOG0736|consensus 953 99.86
KOG0733|consensus 802 99.85
KOG0730|consensus 693 99.84
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.81
KOG0734|consensus 752 99.79
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.78
KOG0740|consensus 428 99.74
KOG0735|consensus 952 99.73
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.73
KOG0727|consensus 408 99.72
KOG0728|consensus 404 99.72
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.71
KOG0726|consensus 440 99.7
KOG0737|consensus 386 99.69
KOG0731|consensus 774 99.68
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.67
CHL00195 489 ycf46 Ycf46; Provisional 99.66
KOG0729|consensus 435 99.63
KOG0652|consensus 424 99.62
KOG0651|consensus 388 99.62
KOG0730|consensus 693 99.61
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.55
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.55
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.55
CHL00206 2281 ycf2 Ycf2; Provisional 99.52
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.49
PF00004132 AAA: ATPase family associated with various cellula 99.49
CHL00176 638 ftsH cell division protein; Validated 99.47
KOG0741|consensus 744 99.43
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.42
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.4
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.39
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.37
KOG0732|consensus 1080 99.34
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.09
KOG0744|consensus 423 99.05
CHL00095 821 clpC Clp protease ATP binding subunit 98.93
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.9
CHL00181 287 cbbX CbbX; Provisional 98.88
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.84
PRK10865 857 protein disaggregation chaperone; Provisional 98.75
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.72
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.72
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.69
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 98.66
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.64
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 98.62
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 98.61
KOG0736|consensus 953 98.59
KOG0742|consensus 630 98.55
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.55
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.55
KOG0745|consensus 564 98.52
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.46
KOG2028|consensus 554 98.4
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 98.2
smart00382148 AAA ATPases associated with a variety of cellular 98.04
KOG0735|consensus 952 98.02
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.02
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 97.82
PRK13342 413 recombination factor protein RarA; Reviewed 97.8
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.78
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.66
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.56
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.54
PRK04195 482 replication factor C large subunit; Provisional 97.51
PRK04132 846 replication factor C small subunit; Provisional 97.5
KOG0741|consensus 744 97.46
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 97.44
KOG1969|consensus 877 97.4
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.4
KOG2004|consensus 906 97.34
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 97.33
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.32
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 97.31
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.3
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.21
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.21
PRK13341 725 recombination factor protein RarA/unknown domain f 97.2
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.17
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.14
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.12
PRK14086 617 dnaA chromosomal replication initiation protein; P 96.96
PHA02544 316 44 clamp loader, small subunit; Provisional 96.92
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.81
PF13173128 AAA_14: AAA domain 96.73
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 96.71
PRK07952244 DNA replication protein DnaC; Validated 96.51
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.48
PRK12422 445 chromosomal replication initiation protein; Provis 96.48
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.41
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.41
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 96.39
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.37
PLN03025 319 replication factor C subunit; Provisional 96.29
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.08
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.07
CHL00095 821 clpC Clp protease ATP binding subunit 96.02
PRK06893 229 DNA replication initiation factor; Validated 95.99
PRK12402 337 replication factor C small subunit 2; Reviewed 95.89
PRK14087 450 dnaA chromosomal replication initiation protein; P 95.83
COG0714 329 MoxR-like ATPases [General function prediction onl 95.65
PRK07940 394 DNA polymerase III subunit delta'; Validated 95.65
PTZ00112 1164 origin recognition complex 1 protein; Provisional 95.65
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 95.64
PHA02244 383 ATPase-like protein 95.58
PRK08181269 transposase; Validated 95.55
PRK08116268 hypothetical protein; Validated 95.47
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 95.33
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.31
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 95.22
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 95.22
PRK09183259 transposase/IS protein; Provisional 95.22
PRK05642 234 DNA replication initiation factor; Validated 95.16
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 95.12
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 95.09
PRK08903 227 DnaA regulatory inactivator Hda; Validated 95.09
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.99
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 94.96
PRK09376 416 rho transcription termination factor Rho; Provisio 94.86
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.81
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 94.79
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 94.75
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.71
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 94.71
PRK08727 233 hypothetical protein; Validated 94.63
PF12774 231 AAA_6: Hydrolytic ATP binding site of dynein motor 94.6
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 94.55
KOG0743|consensus 457 94.52
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 94.49
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 94.45
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.41
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.41
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 94.37
PRK12377248 putative replication protein; Provisional 94.34
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.28
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 94.26
PRK10865 857 protein disaggregation chaperone; Provisional 94.19
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 94.15
PRK08939306 primosomal protein DnaI; Reviewed 94.09
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.96
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 93.95
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 93.95
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 93.66
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 93.6
PRK08084 235 DNA replication initiation factor; Provisional 93.6
PRK06526254 transposase; Provisional 93.5
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 93.26
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 93.19
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 93.19
PRK06921266 hypothetical protein; Provisional 93.17
PF14516 331 AAA_35: AAA-like domain 92.97
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.94
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 92.9
KOG1051|consensus 898 92.72
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.7
PRK06835329 DNA replication protein DnaC; Validated 92.66
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 92.63
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.51
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 92.3
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 92.28
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 92.21
KOG0732|consensus 1080 92.19
COG0593 408 DnaA ATPase involved in DNA replication initiation 92.16
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 92.09
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 91.82
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 91.61
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 91.61
PRK15424 538 propionate catabolism operon regulatory protein Pr 91.55
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 91.35
PRK05022 509 anaerobic nitric oxide reductase transcription reg 91.33
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 91.22
PRK00440 319 rfc replication factor C small subunit; Reviewed 91.14
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 91.03
PRK08118167 topology modulation protein; Reviewed 90.73
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 90.66
KOG1051|consensus 898 90.45
COG2607 287 Predicted ATPase (AAA+ superfamily) [General funct 90.06
PRK10365 441 transcriptional regulatory protein ZraR; Provision 89.93
KOG0989|consensus 346 89.75
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 89.56
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 89.1
COG2204 464 AtoC Response regulator containing CheY-like recei 88.76
cd01128 249 rho_factor Transcription termination factor rho is 88.54
cd00338137 Ser_Recombinase Serine Recombinase family, catalyt 88.32
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 88.31
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 88.31
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 88.21
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 87.98
PRK11823 446 DNA repair protein RadA; Provisional 87.71
PRK11608 326 pspF phage shock protein operon transcriptional ac 87.63
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 87.19
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 86.91
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 86.69
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 86.07
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 85.96
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 85.76
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 85.64
KOG1942|consensus 456 85.54
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 85.48
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 85.25
PRK15115 444 response regulator GlrR; Provisional 84.96
PRK07261171 topology modulation protein; Provisional 84.65
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 84.41
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 84.07
COG0703172 AroK Shikimate kinase [Amino acid transport and me 83.62
PF07693 325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 83.42
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 83.41
PRK13531 498 regulatory ATPase RavA; Provisional 83.38
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 83.36
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 82.06
PRK06620 214 hypothetical protein; Validated 81.98
COG4130 272 Predicted sugar epimerase [Carbohydrate transport 81.88
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 81.6
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 81.38
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 80.87
PRK13947171 shikimate kinase; Provisional 80.84
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 80.73
PRK07631 475 amidophosphoribosyltransferase; Provisional 80.69
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 80.27
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 80.25
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 80.21
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 80.18
>KOG0733|consensus Back     alignment and domain information
Probab=99.89  E-value=1.7e-23  Score=147.48  Aligned_cols=66  Identities=36%  Similarity=0.702  Sum_probs=64.3

Q ss_pred             hHHHHHHHHHhCCcEEEEchhhhhhcccChHHHHHHHHHHHHHhcCCeEEEEccccccccccccCC
Q psy3868           3 YRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKRE   68 (69)
Q Consensus         3 T~la~aia~~~~~~~~~v~~~~l~~~~~ges~~~l~~if~~a~~~~p~iifiDEid~i~~~r~~~~   68 (69)
                      |+||||+|+|.|.+|+.|.+++|+++|+||+|+.||++|++|+.++||||||||+|+|+++|++..
T Consensus       559 TLlAKAVANEag~NFisVKGPELlNkYVGESErAVR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~  624 (802)
T KOG0733|consen  559 TLLAKAVANEAGANFISVKGPELLNKYVGESERAVRQVFQRARASAPCVIFFDEIDALVPRRSDEG  624 (802)
T ss_pred             HHHHHHHhhhccCceEeecCHHHHHHHhhhHHHHHHHHHHHhhcCCCeEEEecchhhcCcccCCCC
Confidence            899999999999999999999999999999999999999999999999999999999999999764



>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>KOG1969|consensus Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG1051|consensus Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd00338 Ser_Recombinase Serine Recombinase family, catalytic domain; a DNA binding domain may be present either N- or C-terminal to the catalytic domain Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG4130 Predicted sugar epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
1e32_A 458 Structure Of The N-Terminal Domain And The D1 Aaa D 1e-23
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 1e-23
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 1e-23
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 1e-23
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 2e-23
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 2e-23
2x8a_A 274 Human Nuclear Valosin Containing Protein Like (Nvl) 4e-09
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 7e-08
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 1e-07
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 7e-07
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 8e-07
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 1e-06
4b4t_I 437 Near-Atomic Resolution Structural Model Of The Yeas 2e-06
4b4t_M 434 Near-Atomic Resolution Structural Model Of The Yeas 3e-06
2rko_A 331 Crystal Structure Of The Vps4p-Dimer Length = 331 3e-06
1lv7_A 257 Crystal Structure Of The Aaa Domain Of Ftsh Length 3e-06
3eie_A 322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 5e-06
3eih_A 340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 6e-06
2qp9_X 355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 7e-06
2r62_A 268 Crystal Structure Of Helicobacter Pylori Atp Depend 1e-05
3d8b_A 357 Crystal Structure Of Human Fidgetin-Like Protein 1 3e-05
4b4t_J 405 Near-Atomic Resolution Structural Model Of The Yeas 1e-04
4b4t_L 437 Near-Atomic Resolution Structural Model Of The Yeas 2e-04
1ixz_A 254 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-04
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 3e-04
2ce7_A 476 Edta Treated Length = 476 3e-04
1iy2_A 278 Crystal Structure Of The Ftsh Atpase Domain From Th 3e-04
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 3e-04
2qz4_A 262 Human Paraplegin, Aaa Domain In Complex With Adp Le 3e-04
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-04
3vfd_A 389 Human Spastin Aaa Domain Length = 389 4e-04
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure

Iteration: 1

Score = 104 bits (260), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 50/53 (94%), Positives = 53/53 (100%) Query: 14 GAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREK 66 GAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIFIDELDAIAPKREK Sbjct: 263 GAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREK 315
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 6e-27
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-24
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 8e-20
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 4e-21
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-19
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 6e-19
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-19
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 5e-16
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 5e-16
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 2e-15
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 2e-15
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 4e-15
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-14
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-14
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 5e-14
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 1e-09
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-09
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 3e-09
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 3e-09
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 4e-09
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 5e-08
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 5e-08
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
 Score = 99.9 bits (249), Expect = 6e-27
 Identities = 52/64 (81%), Positives = 57/64 (89%), Gaps = 3/64 (4%)

Query: 6   TTLCR---DSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAP 62
           T + R   +  GAFFFLINGPEIMSKLAGESESNLRKAFEEA+KN+P+IIFIDELDAIAP
Sbjct: 252 TLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAP 311

Query: 63  KREK 66
           KREK
Sbjct: 312 KREK 315


>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.84
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.82
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.81
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.8
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.8
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.78
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.78
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.74
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.59
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.56
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.56
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.53
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.5
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.49
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.46
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.46
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.46
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.43
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.43
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.43
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.41
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.4
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.37
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.36
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.34
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.27
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.26
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.21
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.11
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.09
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.03
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.01
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.93
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.74
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.71
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.67
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.63
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.6
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.6
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.55
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.53
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 98.25
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.25
3pvs_A 447 Replication-associated recombination protein A; ma 98.23
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.18
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.15
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.14
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.06
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.04
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.97
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.94
3co5_A143 Putative two-component system transcriptional RES 97.92
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.91
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.91
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.89
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.88
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.74
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.7
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.69
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.64
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.45
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.43
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.11
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.1
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.09
2chg_A 226 Replication factor C small subunit; DNA-binding pr 97.06
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 96.88
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.84
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 96.83
3bos_A 242 Putative DNA replication factor; P-loop containing 96.81
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.76
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.7
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.63
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.49
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 96.47
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.47
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.25
2chq_A 319 Replication factor C small subunit; DNA-binding pr 96.14
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.09
2r44_A 331 Uncharacterized protein; putative ATPase, structur 95.84
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 95.72
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.6
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 95.58
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 95.54
2fna_A 357 Conserved hypothetical protein; structural genomic 95.52
2qgz_A308 Helicase loader, putative primosome component; str 95.38
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.14
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 94.84
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 94.7
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.33
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 93.94
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 93.79
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 92.34
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 92.21
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 91.64
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 90.17
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 89.72
1xp8_A 366 RECA protein, recombinase A; recombination, radior 86.44
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 86.05
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 85.22
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 84.57
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 84.5
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 83.52
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 82.82
3imk_A158 Putative molybdenum carrier protein; YP_461806.1, 82.35
2cvh_A220 DNA repair and recombination protein RADB; filamen 81.06
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.84  E-value=4e-21  Score=129.74  Aligned_cols=65  Identities=31%  Similarity=0.502  Sum_probs=62.8

Q ss_pred             hHHHHHHHHHhCCcEEEEchhhhhhcccChHHHHHHHHHHHHHhcCCeEEEEccccccccccccC
Q psy3868           3 YRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKR   67 (69)
Q Consensus         3 T~la~aia~~~~~~~~~v~~~~l~~~~~ges~~~l~~if~~a~~~~p~iifiDEid~i~~~r~~~   67 (69)
                      |++|+++|++++.+|+.++++++.++|+|+++++|+++|+.|+.++||||||||+|+++++|...
T Consensus       196 TllAkAiA~e~~~~f~~v~~s~l~sk~vGese~~vr~lF~~Ar~~aP~IIFiDEiDai~~~R~~~  260 (405)
T 4b4t_J          196 TLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG  260 (405)
T ss_dssp             HHHHHHHHHHHTCEEEEEEGGGGSCSSTTHHHHHHHHHHHHHHHTCSEEEEEESSSCCTTSCSCS
T ss_pred             HHHHHHHHHhhCCCceEEEhHHhhccccchHHHHHHHHHHHHHHhCCceEeeecchhhccCCCCC
Confidence            89999999999999999999999999999999999999999999999999999999999988653



>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3imk_A Putative molybdenum carrier protein; YP_461806.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE MES PG4 PG6; 1.45A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 69
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 7e-18
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 2e-17
d1w44a_ 321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 3e-10
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 2e-07
d1svma_ 362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-04
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
 Score = 71.8 bits (176), Expect = 7e-18
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 1   MSYRLTTLCR---DSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDEL 57
                T L +         FF I+G + +    G   S +R  FE+A K +P IIFIDE+
Sbjct: 54  PGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEI 113

Query: 58  DAIAPKRE 65
           DA+  +R 
Sbjct: 114 DAVGRQRG 121


>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.78
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.78
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.73
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.68
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.66
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.61
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.47
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.48
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.46
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 98.26
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.12
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 98.02
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.82
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 97.75
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.7
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.62
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 97.14
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 97.03
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.88
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 96.66
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 96.16
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 95.72
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 95.53
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.35
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 93.69
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 93.51
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 91.62
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 89.83
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 88.87
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 87.85
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.67
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 87.65
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.2
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 85.7
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 85.55
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 84.85
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.66
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 81.14
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]
Probab=99.78  E-value=1.5e-19  Score=113.58  Aligned_cols=65  Identities=28%  Similarity=0.510  Sum_probs=59.1

Q ss_pred             hHHHHHHHHHhCCcEEEEchhhhhhcccChHHHHHHHHHHHHHhcCCeEEEEccccccccccccC
Q psy3868           3 YRLTTLCRDSLGAFFFLINGPEIMSKLAGESESNLRKAFEEADKNSPSIIFIDELDAIAPKREKR   67 (69)
Q Consensus         3 T~la~aia~~~~~~~~~v~~~~l~~~~~ges~~~l~~if~~a~~~~p~iifiDEid~i~~~r~~~   67 (69)
                      |++|+++|++++++++.++++++.++|+|+++++++++|+.|+.++||||||||+|+|+++|+..
T Consensus        56 T~la~aia~~~~~~~~~i~~~~l~~~~~g~~~~~l~~~f~~a~~~~p~Ii~iDeid~l~~~r~~~  120 (247)
T d1ixza_          56 THLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVGRKRGSG  120 (247)
T ss_dssp             HHHHHHHHHHTTCCEEEEEHHHHHHSCTTHHHHHHHHHHHHHTTSSSEEEEEETHHHHHC-----
T ss_pred             hHHHHHHHHHcCCCEEEEEhHHhhhccccHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCC
Confidence            78999999999999999999999999999999999999999999999999999999999988653



>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure