Diaphorina citri psyllid: psy3876

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------

MASSRFSGVLQLTDLDDFIGPSQECIKPIPIEKPSGPRTGAKIRIQDDGAYIQETNGREEKLKKVEISLTDCLACSGCITSAESVLITQQSHEEVMKVIRENNAHKASSNENTKTIVLSLAIQPVLSLGAKFALSHEQVVAKLCGFFKRLGVDLVLDVGIAHCFSLVELENEFLDRFLSGGGPLFTSECPGWVCYAEKSHGEFILPYISRVKSPQQVMGSLIKTHLAEKLGVHPSHIYHVTLMPCYDKKLEASRADFYNEELGYRDVDCVITAVELEVLLANELATTTLQEEKDGILDWPWDEHNPHRMLLVNGTGSGGYAHNVLSHAIRQLCPGESPVVEFKPLRNPDIREATFTCGDVTLRFCIANGFRNIQNLIQKLKRKRLPYDFIEIMACPSGCLNGGAQIRNEKVASPKETALELETILCDLAKSEPRENATLEHLYKAWLGGKSTDKGKHMLNTSYHNIPKNNIALNVKW

cccccccccccccccccccccccccEEcccccccccccccccEEEEccccEEEcccccccccccccccccccccccccHHHccHHHHEEccHHHHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccccccccccccCEEEcHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEcccccCEEEEEECccEEEEEEEEEcHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHccccEEECccccccccccccc

*****FS*VLQLTDLDDFIGPSQECIKPIPI*************IQDDGAYI*********LKKVEISLTDCLACSGCITSAESVLITQQSHEEVMKVIRENNAHKASSNENTKTIVLSLAIQPVLSLGAKFALSHEQVVAKLCGFFKRLGVDLVLDVGIAHCFSLVELENEFLDRFLSGGGPLFTSECPGWVCYAEKSHGEFILPYISRVKSPQQVMGSLIKTHLAEKLGVHPSHIYHVTLMPCYDKKLEASRADFYNEELGYRDVDCVITAVELEVLLANELATTTLQEEKDGILDWPWDEHNPHRMLLVNGTGSGGYAHNVLSHAIRQLCPGESPVVEFKPLRNPDIREATFTCGDVTLRFCIANGFRNIQNLIQKLKRKRLPYDFIEIMACPSGCLNGGAQIRNEKV*****TALELETILCDLAKSEPRENATLEHLYKAWLGGKSTDKGKHMLNTSYHNIPKNN*****KW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable cytosolic Fe-S cluster assembly factor AGAP009023	Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins.	very confident	Q7PWB8
Probable cytosolic Fe-S cluster assembly factor GA29080	Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins.	very confident	B5DK31
Cytosolic Fe-S cluster assembly factor NARFL	Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. Seems to negatively regulate the level of HIF1A expression, although this effect could be indirect.	confident	Q5RF36

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	confident	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0032364 [BP]	oxygen homeostasis	probable	GO:0033483, GO:0048878, GO:0042592, GO:0008150, GO:0065007, GO:0065008
GO:0097361 [CC]	CIA complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0016226 [BP]	iron-sulfur cluster assembly	probable	GO:0022607, GO:0009058, GO:0016043, GO:0031163, GO:0044085, GO:0008150, GO:0008152, GO:0071840
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0001666 [BP]	response to hypoxia	probable	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0005638 [CC]	lamin filament	probable	GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0034399, GO:0005575, GO:0045111, GO:0031981, GO:0005634, GO:0044430, GO:0005652, GO:0005856, GO:0005882, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0005521 [MF]	lamin binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0051539 [MF]	4 iron, 4 sulfur cluster binding	probable	GO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0055093 [BP]	response to hyperoxia	probable	GO:0009628, GO:0050896, GO:0036296, GO:0006950, GO:0008150, GO:0070482
GO:0022008 [BP]	neurogenesis	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LX4, chain A
Confidence level:very confident
Coverage over the Query: 94-468
View the alignment between query and template
View the model in PyMOL

Template: 1HFE, chain L
Confidence level:very confident
Coverage over the Query: 3-49,63-417
View the alignment between query and template
View the model in PyMOL