Diaphorina citri psyllid: psy3879

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MLSKSGDPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRSE
cccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccc
**************LQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSKSGDPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Geranylgeranyl pyrophosphate synthase Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.confidentP56966
Geranylgeranyl pyrophosphate synthase Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.confidentQ6F596
Geranylgeranyl pyrophosphate synthase Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.confidentO95749

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004311 [MF]farnesyltranstransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0004659, GO:0003824
GO:0016117 [BP]carotenoid biosynthetic processprobableGO:0044249, GO:1901576, GO:0044710, GO:0042440, GO:0016109, GO:0016108, GO:0071704, GO:0006629, GO:0006721, GO:0006720, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0044255, GO:0046148, GO:0008610, GO:0044238, GO:0044237, GO:0008299, GO:0016116, GO:0016114
GO:0004337 [MF]geranyltranstransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0004659, GO:0003824
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0008354 [BP]germ cell migrationprobableGO:0040011, GO:0044702, GO:0051674, GO:0048609, GO:0032504, GO:0048870, GO:0032501, GO:0009987, GO:0019953, GO:0006928, GO:0022414, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0016477, GO:0051179, GO:0007276, GO:0000003
GO:0035050 [BP]embryonic heart tube developmentprobableGO:0072358, GO:0007507, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.10(2E,6E)-farnesyl diphosphate synthase.probable
2.5.1.1Transferred entry: 2.5.1.18.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Q80, chain A
Confidence level:very confident
Coverage over the Query: 8-201
View the alignment between query and template
View the model in PyMOL
Template: 2Q80, chain A
Confidence level:very confident
Coverage over the Query: 151-247
View the alignment between query and template
View the model in PyMOL