Psyllid ID: psy3879

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MLSKSGDPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRSE
cccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccc
cccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccHHHHHHHHHHHHHHcEEEEEEcccHHHcccccHHHcccccccHHHHccccccccccHHHHHHHccc
mlsksgdpeqdekllqpytyisqvpgkqIRTKLAYAFNnwlnipeekLLAIGDIIQMLhnsslliddiednsilrrgipvahSIYGIASTINAANYVVAIALEKVqslghpeatAVYTEQLLELHRgqgmeiywrdnytcpseeeyRTMTIRKFDmriddiednsilrrgipvahSIYGIASTINAANYVVAIALEKVqslghpeatAVYTEQLLELHRgqgmeiywrdnytcpseeeyrtmtirse
mlsksgdpeqdekllqpytyisqvpgkQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQgmeiywrdnytcpseeeyrtmtirse
MLSKSGDPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRSE
**************LQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCP*************
**************LQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRS*
**********DEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRSE
******DPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRSE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSKSGDPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query247 2.2.26 [Sep-21-2011]
P56966300 Geranylgeranyl pyrophosph yes N/A 0.566 0.466 0.664 1e-54
O95749300 Geranylgeranyl pyrophosph yes N/A 0.566 0.466 0.664 1e-54
Q6F596300 Geranylgeranyl pyrophosph yes N/A 0.566 0.466 0.642 3e-53
Q9WTN0300 Geranylgeranyl pyrophosph yes N/A 0.566 0.466 0.635 1e-52
P24322433 Geranylgeranyl pyrophosph N/A N/A 0.587 0.334 0.527 2e-44
Q9P885303 Geranylgeranyl pyrophosph N/A N/A 0.566 0.462 0.564 2e-43
Q54BK1303 Geranylgeranyl pyrophosph yes N/A 0.587 0.478 0.531 3e-41
B2DBE9424 Geranylgeranyl pyrophosph N/A N/A 0.821 0.478 0.415 6e-40
Q92236418 Geranylgeranyl pyrophosph N/A N/A 0.587 0.346 0.468 2e-38
Q758K0320 Geranylgeranyl pyrophosph yes N/A 0.582 0.45 0.417 2e-31
>sp|P56966|GGPPS_BOVIN Geranylgeranyl pyrophosphate synthase OS=Bos taurus GN=GGPS1 PE=1 SV=2 Back     alignment and function desciption
 Score =  213 bits (542), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 118/140 (84%)

Query: 14  LLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSI 73
           LL+PY Y+ Q+PGKQ+RTKL+ AFN+WL +PE+KL  I ++ +MLHN+SLLIDDIEDNS 
Sbjct: 12  LLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNSK 71

Query: 74  LRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIY 133
           LRRG PVAHSIYGI S IN+ANYV  + LEKV +L HP+A  ++T QLLELH+GQG++IY
Sbjct: 72  LRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLNHPDAVKLFTRQLLELHQGQGLDIY 131

Query: 134 WRDNYTCPSEEEYRTMTIRK 153
           WRDNYTCP+EEEY+ M ++K
Sbjct: 132 WRDNYTCPTEEEYKAMVLQK 151
Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.
Bos taurus (taxid: 9913)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 0
>sp|O95749|GGPPS_HUMAN Geranylgeranyl pyrophosphate synthase OS=Homo sapiens GN=GGPS1 PE=1 SV=1 Back     alignment and function description
>sp|Q6F596|GGPPS_RAT Geranylgeranyl pyrophosphate synthase OS=Rattus norvegicus GN=Ggps1 PE=2 SV=1 Back     alignment and function description
>sp|Q9WTN0|GGPPS_MOUSE Geranylgeranyl pyrophosphate synthase OS=Mus musculus GN=Ggps1 PE=2 SV=1 Back     alignment and function description
>sp|P24322|GGPPS_NEUCR Geranylgeranyl pyrophosphate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-3 PE=2 SV=2 Back     alignment and function description
>sp|Q9P885|GGPPS_MUCCL Geranylgeranyl pyrophosphate synthase OS=Mucor circinelloides f. lusitanicus GN=carG PE=1 SV=1 Back     alignment and function description
>sp|Q54BK1|GGPPS_DICDI Geranylgeranyl pyrophosphate synthase OS=Dictyostelium discoideum GN=ggps1 PE=3 SV=1 Back     alignment and function description
>sp|B2DBE9|GGS4_PHOAM Geranylgeranyl pyrophosphate synthase D OS=Phomopsis amygdali GN=GGS-D PE=1 SV=1 Back     alignment and function description
>sp|Q92236|GGPPS_GIBFU Geranylgeranyl pyrophosphate synthase OS=Gibberella fujikuroi GN=GGS PE=3 SV=1 Back     alignment and function description
>sp|Q758K0|GGPPS_ASHGO Geranylgeranyl pyrophosphate synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BTS1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
156554759314 PREDICTED: geranylgeranyl pyrophosphate 0.611 0.480 0.847 6e-70
194747643338 GF24684 [Drosophila ananassae] gi|190623 0.607 0.443 0.786 5e-67
125977318339 GA21189 [Drosophila pseudoobscura pseudo 0.607 0.442 0.786 9e-67
195376189337 GJ13129 [Drosophila virilis] gi|19415403 0.607 0.445 0.78 2e-66
312376381299 hypothetical protein AND_12794 [Anophele 0.607 0.501 0.786 4e-66
158286675324 AGAP006894-PA [Anopheles gambiae str. PE 0.607 0.462 0.78 5e-66
2944400338 geranylgeranyl pyrophosphate synthase [D 0.607 0.443 0.78 5e-66
195126086337 GI12986 [Drosophila mojavensis] gi|19391 0.607 0.445 0.78 5e-66
24660002338 quemao, isoform A [Drosophila melanogast 0.607 0.443 0.78 5e-66
195492530338 GE21608 [Drosophila yakuba] gi|194180132 0.607 0.443 0.78 5e-66
>gi|156554759|ref|XP_001605679.1| PREDICTED: geranylgeranyl pyrophosphate synthase-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  269 bits (688), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 128/151 (84%), Positives = 137/151 (90%)

Query: 3   SKSGDPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSS 62
           S+SGD EQDEKLLQP+TYI QVPGKQIR KLA+AFN WL IP EKL A+GDI QMLHNSS
Sbjct: 11  SQSGDKEQDEKLLQPFTYILQVPGKQIRGKLAHAFNYWLKIPVEKLQAVGDITQMLHNSS 70

Query: 63  LLIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLL 122
           LLIDDI+DNSILRRGIPVAHSIYG+ASTINAANYV+ IALE+V SL HPEAT VYTEQLL
Sbjct: 71  LLIDDIQDNSILRRGIPVAHSIYGVASTINAANYVLFIALERVISLNHPEATQVYTEQLL 130

Query: 123 ELHRGQGMEIYWRDNYTCPSEEEYRTMTIRK 153
           ELHRGQGMEIYWRDN+ CPSE EYRTMTIRK
Sbjct: 131 ELHRGQGMEIYWRDNFICPSEAEYRTMTIRK 161

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194747643|ref|XP_001956261.1| GF24684 [Drosophila ananassae] gi|190623543|gb|EDV39067.1| GF24684 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|125977318|ref|XP_001352692.1| GA21189 [Drosophila pseudoobscura pseudoobscura] gi|195174424|ref|XP_002027974.1| GL21354 [Drosophila persimilis] gi|54641441|gb|EAL30191.1| GA21189 [Drosophila pseudoobscura pseudoobscura] gi|194115684|gb|EDW37727.1| GL21354 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195376189|ref|XP_002046879.1| GJ13129 [Drosophila virilis] gi|194154037|gb|EDW69221.1| GJ13129 [Drosophila virilis] Back     alignment and taxonomy information
>gi|312376381|gb|EFR23484.1| hypothetical protein AND_12794 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158286675|ref|XP_308860.3| AGAP006894-PA [Anopheles gambiae str. PEST] gi|157020582|gb|EAA03964.3| AGAP006894-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|2944400|gb|AAC05273.1| geranylgeranyl pyrophosphate synthase [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195126086|ref|XP_002007505.1| GI12986 [Drosophila mojavensis] gi|193919114|gb|EDW17981.1| GI12986 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|24660002|ref|NP_523958.2| quemao, isoform A [Drosophila melanogaster] gi|281365769|ref|NP_001163370.1| quemao, isoform B [Drosophila melanogaster] gi|7295252|gb|AAF50574.1| quemao, isoform A [Drosophila melanogaster] gi|17946375|gb|AAL49221.1| RE65121p [Drosophila melanogaster] gi|272455081|gb|ACZ94641.1| quemao, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195492530|ref|XP_002094031.1| GE21608 [Drosophila yakuba] gi|194180132|gb|EDW93743.1| GE21608 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
FB|FBgn0019662338 qm "quemao" [Drosophila melano 0.607 0.443 0.78 2.6e-63
UNIPROTKB|F1NHT9292 GGPS1 "Uncharacterized protein 0.587 0.496 0.627 6.9e-53
UNIPROTKB|P56966300 GGPS1 "Geranylgeranyl pyrophos 0.566 0.466 0.664 1.7e-50
UNIPROTKB|C9J6G3230 GGPS1 "Geranylgeranyl pyrophos 0.566 0.608 0.664 2.2e-50
UNIPROTKB|C9J7M1242 GGPS1 "Geranylgeranyl pyrophos 0.566 0.578 0.664 2.2e-50
UNIPROTKB|O95749300 GGPS1 "Geranylgeranyl pyrophos 0.566 0.466 0.664 2.2e-50
UNIPROTKB|F1RGX0300 GGPS1 "Uncharacterized protein 0.566 0.466 0.664 2.2e-50
ZFIN|ZDB-GENE-030131-8742350 ggps1 "geranylgeranyl diphosph 0.566 0.4 0.678 3.6e-50
UNIPROTKB|E2R3P8300 GGPS1 "Uncharacterized protein 0.566 0.466 0.657 4.6e-50
RGD|1359680300 Ggps1 "geranylgeranyl diphosph 0.587 0.483 0.630 2.5e-49
FB|FBgn0019662 qm "quemao" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 626 (225.4 bits), Expect = 2.6e-63, Sum P(2) = 2.6e-63
 Identities = 117/150 (78%), Positives = 132/150 (88%)

Query:     4 KSGDPEQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSL 63
             KS   EQDE LLQP+TYI Q+PGKQ R++LA AFN+WL IP EKL  IGDI+QMLHNSSL
Sbjct:    14 KSTQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSL 73

Query:    64 LIDDIEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLE 123
             LIDDIEDNSILRRG+PVAHSIYG+ASTINAANY + +ALEKVQ L HPEAT VYTEQLLE
Sbjct:    74 LIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLE 133

Query:   124 LHRGQGMEIYWRDNYTCPSEEEYRTMTIRK 153
             LHRGQGMEIYWRD++TCPSE +Y+ MT+RK
Sbjct:   134 LHRGQGMEIYWRDSFTCPSESDYKLMTVRK 163
GO:0004337 "geranyltranstransferase activity" evidence=ISS
GO:0004161 "dimethylallyltranstransferase activity" evidence=ISS
GO:0004311 "farnesyltranstransferase activity" evidence=ISS;NAS
GO:0008299 "isoprenoid biosynthetic process" evidence=IEA
GO:0008354 "germ cell migration" evidence=IMP
GO:0035050 "embryonic heart tube development" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1NHT9 GGPS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P56966 GGPS1 "Geranylgeranyl pyrophosphate synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9J6G3 GGPS1 "Geranylgeranyl pyrophosphate synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9J7M1 GGPS1 "Geranylgeranyl pyrophosphate synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O95749 GGPS1 "Geranylgeranyl pyrophosphate synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGX0 GGPS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8742 ggps1 "geranylgeranyl diphosphate synthase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3P8 GGPS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1359680 Ggps1 "geranylgeranyl diphosphate synthase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6F596GGPPS_RAT2, ., 5, ., 1, ., 1, 00.64280.56680.4666yesN/A
Q9WTN0GGPPS_MOUSE2, ., 5, ., 1, ., 1, 00.63570.56680.4666yesN/A
Q54BK1GGPPS_DICDI2, ., 5, ., 1, ., 1, 00.53100.58700.4785yesN/A
O95749GGPPS_HUMAN2, ., 5, ., 1, ., 1, 00.66420.56680.4666yesN/A
P56966GGPPS_BOVIN2, ., 5, ., 1, ., 1, 00.66420.56680.4666yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.100.824
4th Layer2.5.1.10.824
3rd Layer2.5.10.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
cd00685259 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphat 2e-42
cd00867236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate S 3e-29
pfam00348260 pfam00348, polyprenyl_synt, Polyprenyl synthetase 6e-26
COG0142322 COG0142, IspA, Geranylgeranyl pyrophosphate syntha 2e-25
cd00685 259 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphat 1e-22
cd00385243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynth 1e-18
cd00867 236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate S 5e-18
pfam00348 260 pfam00348, polyprenyl_synt, Polyprenyl synthetase 7e-14
cd00385 243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynth 7e-14
COG0142 322 COG0142, IspA, Geranylgeranyl pyrophosphate syntha 2e-12
PRK10888323 PRK10888, PRK10888, octaprenyl diphosphate synthas 2e-06
CHL00151323 CHL00151, preA, prenyl transferase; Reviewed 3e-06
TIGR02748319 TIGR02748, GerC3_HepT, heptaprenyl diphosphate syn 3e-06
TIGR02749322 TIGR02749, prenyl_cyano, solanesyl diphosphate syn 5e-06
PRK10581299 PRK10581, PRK10581, geranyltranstransferase; Provi 9e-06
PLN02890422 PLN02890, PLN02890, geranyl diphosphate synthase 3e-05
PLN02857416 PLN02857, PLN02857, octaprenyl-diphosphate synthas 8e-05
TIGR02748 319 TIGR02748, GerC3_HepT, heptaprenyl diphosphate syn 0.001
>gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information 
 Score =  144 bits (366), Expect = 2e-42
 Identities = 52/149 (34%), Positives = 81/149 (54%), Gaps = 5/149 (3%)

Query: 9   EQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPE-EKLLAIGDIIQMLHNSSLLIDD 67
            + E L +   Y+    GK++R  L       L  PE E  L +   I++LH +SL+ DD
Sbjct: 1   SEVELLREALRYLLLAGGKRLRPLLVLLAARALGGPELEAALRLAAAIELLHTASLVHDD 60

Query: 68  IEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGH---PEATAVYTEQLLEL 124
           + DNS LRRG P  H ++G A+ I A +Y++A A E +  LG+   P A  +++E +LEL
Sbjct: 61  VMDNSDLRRGKPTVHKVFGNATAILAGDYLLARAFELLARLGNPYYPRALELFSEAILEL 120

Query: 125 HRGQGMEIYWRDNYTCPSEEEYRTMTIRK 153
             GQ +++    + T  +EEEY  +   K
Sbjct: 121 VEGQLLDLLSEYD-TDVTEEEYLRIIRLK 148

These trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) catalyze head-to-tail (HT) (1'-4) condensation reactions. This CD includes all-trans (E)-isoprenyl diphosphate synthases which synthesize various chain length (C10, C15, C20, C25, C30, C35, C40, C45, and C50) linear isoprenyl diphosphates from precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). They catalyze the successive 1'-4 condensation of the 5-carbon IPP to allylic substrates geranyl-, farnesyl-, or geranylgeranyl-diphosphate. Isoprenoid chain elongation reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions (DDXX(XX)D) located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, protecting and stabilizing reactive carbocation intermediates. Farnesyl diphosphate synthases produce the precursors of steroids, cholesterol, sesquiterpenes, farnsylated proteins, heme, and vitamin K12; and geranylgeranyl diphosphate and longer chain synthases produce the precursors of carotenoids, retinoids, diterpenes, geranylgeranylated chlorophylls, ubiquinone, and archaeal ether linked lipids. Isoprenyl diphosphate synthases are widely distributed among archaea, bacteria, and eukareya. Length = 259
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|215873 pfam00348, polyprenyl_synt, Polyprenyl synthetase Back     alignment and domain information
>gnl|CDD|223220 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|215873 pfam00348, polyprenyl_synt, Polyprenyl synthetase Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|223220 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182813 PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|131795 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase component II Back     alignment and domain information
>gnl|CDD|131796 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|182567 PRK10581, PRK10581, geranyltranstransferase; Provisional Back     alignment and domain information
>gnl|CDD|178478 PLN02890, PLN02890, geranyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|215462 PLN02857, PLN02857, octaprenyl-diphosphate synthase Back     alignment and domain information
>gnl|CDD|131795 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase component II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 247
COG0142322 IspA Geranylgeranyl pyrophosphate synthase [Coenzy 100.0
PRK10581299 geranyltranstransferase; Provisional 100.0
TIGR02748319 GerC3_HepT heptaprenyl diphosphate synthase compon 100.0
PRK10888323 octaprenyl diphosphate synthase; Provisional 100.0
TIGR02749322 prenyl_cyano solanesyl diphosphate synthase. Membe 100.0
PLN02890422 geranyl diphosphate synthase 100.0
cd00685259 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthase 100.0
PLN02857416 octaprenyl-diphosphate synthase 100.0
CHL00151323 preA prenyl transferase; Reviewed 100.0
PF00348260 polyprenyl_synt: Polyprenyl synthetase; InterPro: 100.0
KOG0776|consensus384 100.0
KOG0777|consensus322 99.98
cd00867236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases. 99.96
KOG0711|consensus347 99.93
KOG0777|consensus 322 99.72
COG0142 322 IspA Geranylgeranyl pyrophosphate synthase [Coenzy 99.71
TIGR02748 319 GerC3_HepT heptaprenyl diphosphate synthase compon 99.7
PLN02890 422 geranyl diphosphate synthase 99.69
cd00385243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzym 99.68
TIGR02749 322 prenyl_cyano solanesyl diphosphate synthase. Membe 99.67
PRK10888 323 octaprenyl diphosphate synthase; Provisional 99.67
PLN02857 416 octaprenyl-diphosphate synthase 99.63
CHL00151 323 preA prenyl transferase; Reviewed 99.61
cd00685 259 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthase 99.6
PRK10581 299 geranyltranstransferase; Provisional 99.59
PF00348 260 polyprenyl_synt: Polyprenyl synthetase; InterPro: 99.42
cd00867 236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases. 99.33
KOG0776|consensus 384 99.33
cd00385 243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzym 98.53
PF07307212 HEPPP_synt_1: Heptaprenyl diphosphate synthase (HE 97.81
KOG0711|consensus 347 97.57
PF07307212 HEPPP_synt_1: Heptaprenyl diphosphate synthase (HE 86.92
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7.1e-42  Score=304.75  Aligned_cols=175  Identities=29%  Similarity=0.420  Sum_probs=159.1

Q ss_pred             CcchhHHhHHHHhhcCCCcchHHHHHHHHHHhcCCCh----HHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCchhhh
Q psy3879           9 EQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPE----EKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSI   84 (247)
Q Consensus         9 ~~~~~l~~~~~y~~~~~GK~~R~~l~~~~~~~~~~~~----~~~~~~a~avElih~asLihDDI~D~s~~RRG~p~~h~~   84 (247)
                      +.++.+.+++.|.+..||||+||+++++++++++.+.    +++..+|++|||||++|||||||||+|++|||+||+|.+
T Consensus        25 ~~~~~l~~a~~~~~~aGGKrlRP~l~l~~~~~~~~~~~~~~~~~~~~aaavEliH~~SLiHDDvmD~s~~RRG~pt~~~~  104 (322)
T COG0142          25 SDPELLLEAMRYLLLAGGKRLRPLLVLLAAEALGIDLETGGNDALDLAAAIELIHTASLIHDDLMDDDDLRRGKPTVHAK  104 (322)
T ss_pred             cccHHHHHHHHHHHhcCCccHhHHHHHHHHHHcCCCcccchhhHHHHHHHHHHHHHHHHHHhhcccCCCccCCCCCchhH
Confidence            6788999999999999999999999999999998443    368999999999999999999999999999999999999


Q ss_pred             cchhHHHHHHHHHHHHHHHHHHhcCC--hHHHHHHHHHHHHhHhhhhhhhhhccCCCCCCHHHHHHHhHHhhhhhh----
Q psy3879          85 YGIASTINAANYVVAIALEKVQSLGH--PEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRI----  158 (247)
Q Consensus        85 ~G~~~Ai~~gd~l~~~~~~~l~~~~~--~~~~~~~~~~~~~~~~Gq~~dl~~~~~~~~~s~~~Y~~ii~~Kt~~~~----  158 (247)
                      ||+..||++||+|++.+|+++++.+.  +.+.+.+++.+..+|.||.+|+.+..+.  +|+++|++|+++|||.++    
T Consensus       105 ~g~~~AIlaGD~L~~~Af~~l~~~~~~~~~~~~~~~~~~~~~~~GQ~lDl~~~~~~--~t~e~y~~~i~~KTa~L~~~a~  182 (322)
T COG0142         105 FGEATAILAGDALLAAAFELLSKLGSEALEAIKALAEAINGLCGGQALDLAFENKP--VTLEEYLRVIELKTAALFAAAA  182 (322)
T ss_pred             hccHHHHHHHHHHHHHHHHHHHhCCchhHHHHHHHHHHHHHHHHhHHHHHHccCCC--CCHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999977  7899999999999999999999988764  899999999999999998    


Q ss_pred             -------------------------------ccccc------------chhhhcCCCchhhhhcHHHHHH
Q psy3879         159 -------------------------------DDIED------------NSILRRGIPVAHSIYGIASTIN  185 (247)
Q Consensus       159 -------------------------------dd~~d------------~~~lr~g~~t~~~~~g~~~ai~  185 (247)
                                                     ||++|            ++|++.|++|+|.+++.+.+..
T Consensus       183 ~~ga~la~~~~~~~~~l~~~g~~lGlaFQi~DDiLD~~~d~~~lGK~~g~Dl~~gK~T~p~l~~l~~~~~  252 (322)
T COG0142         183 VLGAILAGADEELLEALEDYGRNLGLAFQIQDDILDITGDEEELGKPVGSDLKEGKPTLPVLLALEKANE  252 (322)
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHHhhHHHHHHHHhhcCCCChHHhCCCcchHHHcCCchHHHHHHHHcCch
Confidence                                           77776            2577778888888887775444

>PRK10581 geranyltranstransferase; Provisional Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II Back     alignment and domain information
>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>TIGR02749 prenyl_cyano solanesyl diphosphate synthase Back     alignment and domain information
>PLN02890 geranyl diphosphate synthase Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>PLN02857 octaprenyl-diphosphate synthase Back     alignment and domain information
>CHL00151 preA prenyl transferase; Reviewed Back     alignment and domain information
>PF00348 polyprenyl_synt: Polyprenyl synthetase; InterPro: IPR000092 A variety of isoprenoid compounds are synthesized by various organisms Back     alignment and domain information
>KOG0776|consensus Back     alignment and domain information
>KOG0777|consensus Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>KOG0711|consensus Back     alignment and domain information
>KOG0777|consensus Back     alignment and domain information
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II Back     alignment and domain information
>PLN02890 geranyl diphosphate synthase Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>TIGR02749 prenyl_cyano solanesyl diphosphate synthase Back     alignment and domain information
>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>PLN02857 octaprenyl-diphosphate synthase Back     alignment and domain information
>CHL00151 preA prenyl transferase; Reviewed Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>PRK10581 geranyltranstransferase; Provisional Back     alignment and domain information
>PF00348 polyprenyl_synt: Polyprenyl synthetase; InterPro: IPR000092 A variety of isoprenoid compounds are synthesized by various organisms Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>KOG0776|consensus Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>PF07307 HEPPP_synt_1: Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1; InterPro: IPR009920 This family contains subunit 1 of bacterial heptaprenyl diphosphate synthase (HEPPP synthase) (2 Back     alignment and domain information
>KOG0711|consensus Back     alignment and domain information
>PF07307 HEPPP_synt_1: Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1; InterPro: IPR009920 This family contains subunit 1 of bacterial heptaprenyl diphosphate synthase (HEPPP synthase) (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
2q80_A301 Crystal Structure Of Human Geranylgeranyl Pyrophosp 1e-55
2q80_A 301 Crystal Structure Of Human Geranylgeranyl Pyrophosp 2e-34
2dh4_A340 Geranylgeranyl Pyrophosphate Synthase Length = 340 8e-31
2dh4_A 340 Geranylgeranyl Pyrophosphate Synthase Length = 340 7e-17
2ftz_A284 Crystal Structure Of Geranyltranstransferase (Ec 2. 5e-09
3tc1_A315 Crystal Structure Of Octaprenyl Pyrophosphate Synth 7e-07
3aqb_B325 M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphospha 7e-06
3apz_A348 Apo Form Of Arabidopsis MediumLONG-Chain Length Pre 8e-06
1wy0_A342 Crystal Structure Of Geranylgeranyl Pyrophosphate S 9e-06
3aq0_A348 Ligand-Bound Form Of Arabidopsis MediumLONG-Chain L 1e-05
4fp4_A285 Crystal Structure Of Isoprenoid Synthase A3mx09 (Ta 2e-05
3oyr_A345 Crystal Structure Of Polyprenyl Synthase From Caulo 3e-05
3kra_A295 Mint Heterotetrameric Geranyl Pyrophosphate Synthas 4e-05
1v4h_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-05
1vg4_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-04
1v4e_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-04
2j1p_A293 Geranylgeranyl Diphosphate Synthase From Sinapis Al 2e-04
3lom_A313 Crystal Structure Of Geranyltransferase From Legion 3e-04
1vg6_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 3e-04
1v4j_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 3e-04
1v4i_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 3e-04
3pko_A334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-04
3n3d_A335 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-04
3lmd_A360 Crystal Structure Of Geranylgeranyl Pyrophosphate S 3e-04
2azk_A289 Crystal Structure For The Mutant W136e Of Sulfolobu 3e-04
1vg2_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 3e-04
2for_A323 Crystal Structure Of The Shigella Flexneri Farnesyl 4e-04
2azl_A299 Crystal Structure For The Mutant F117e Of Thermotog 4e-04
1rqj_A299 Active Conformation Of Farnesyl Pyrophosphate Synth 5e-04
1rqi_A300 Active Conformation Of Farnesyl Pyrophosphate Synth 5e-04
4dhd_A358 Crystal Structure Of Isoprenoid Synthase A3msh1 (Ta 5e-04
1vg7_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-04
1v4k_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-04
3uca_A324 Crystal Structure Of Isoprenoid Synthase (Target Ef 6e-04
1wkz_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 6e-04
>pdb|2Q80|A Chain A, Crystal Structure Of Human Geranylgeranyl Pyrophosphate Synthase Bound To Ggpp Length = 301 Back     alignment and structure 
Iteration: 1

 Score =  213 bits (541), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 118/140 (84%)
Query: 14  LLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSI 73
           LL+PY Y+ Q+PGKQ+RTKL+ AFN+WL +PE+KL  I ++ +MLHN+SLLIDDIEDNS 
Sbjct: 13  LLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNSK 72
Query: 74  LRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIY 133
           LRRG PVAHSIYGI S IN+ANYV  + LEKV +L HP+A  ++T QLLELH+GQG++IY
Sbjct: 73  LRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIY 132
Query: 134 WRDNYTCPSEEEYRTMTIRK 153
           WRDNYTCP+EEEY+ M ++K
Sbjct: 133 WRDNYTCPTEEEYKAMVLQK 152
>pdb|2Q80|A Chain A, Crystal Structure Of Human Geranylgeranyl Pyrophosphate Synthase Bound To Ggpp Length = 301 Back     alignment and structure
>pdb|2DH4|A Chain A, Geranylgeranyl Pyrophosphate Synthase Length = 340 Back     alignment and structure
>pdb|2DH4|A Chain A, Geranylgeranyl Pyrophosphate Synthase Length = 340 Back     alignment and structure
>pdb|2FTZ|A Chain A, Crystal Structure Of Geranyltranstransferase (Ec 2.5.1.10) (Tm0161) From Thermotoga Maritima At 1.90 A Resolution Length = 284 Back     alignment and structure
>pdb|3TC1|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Helicobacter Pylori Length = 315 Back     alignment and structure
>pdb|3AQB|B Chain B, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate Synthase In Complex With Magnesium Length = 325 Back     alignment and structure
>pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase Length = 348 Back     alignment and structure
>pdb|1WY0|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthetase From Pyrococcus Horikoshii Ot3 Length = 342 Back     alignment and structure
>pdb|3AQ0|A Chain A, Ligand-Bound Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase (Surface Polar Residue Mutant) Length = 348 Back     alignment and structure
>pdb|4FP4|A Chain A, Crystal Structure Of Isoprenoid Synthase A3mx09 (Target Efi-501993) From Pyrobaculum Calidifontis Length = 285 Back     alignment and structure
>pdb|3OYR|A Chain A, Crystal Structure Of Polyprenyl Synthase From Caulobacter Crescentus Cb15 Complexed With Calcium And Isoprenyl Diphosphate Length = 345 Back     alignment and structure
>pdb|3KRA|A Chain A, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium Length = 295 Back     alignment and structure
>pdb|1V4H|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F52a Mutant Length = 299 Back     alignment and structure
>pdb|1VG4|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128A MUTANT Length = 299 Back     alignment and structure
>pdb|1V4E|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima Length = 299 Back     alignment and structure
>pdb|2J1P|A Chain A, Geranylgeranyl Diphosphate Synthase From Sinapis Alba In Complex With Ggpp Length = 293 Back     alignment and structure
>pdb|3LOM|A Chain A, Crystal Structure Of Geranyltransferase From Legionella Pneumophila Length = 313 Back     alignment and structure
>pdb|1VG6|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123A MUTANT Length = 299 Back     alignment and structure
>pdb|1V4J|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima V73y Mutant Length = 299 Back     alignment and structure
>pdb|1V4I|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132a Mutant Length = 299 Back     alignment and structure
>pdb|3PKO|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Complexed With Citrate Length = 334 Back     alignment and structure
>pdb|3N3D|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Length = 335 Back     alignment and structure
>pdb|3LMD|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Atcc 13032 Length = 360 Back     alignment and structure
>pdb|2AZK|A Chain A, Crystal Structure For The Mutant W136e Of Sulfolobus Solfataricus Hexaprenyl Pyrophosphate Synthase Length = 289 Back     alignment and structure
>pdb|1VG2|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima A76y Mutant Length = 299 Back     alignment and structure
>pdb|2FOR|A Chain A, Crystal Structure Of The Shigella Flexneri Farnesyl Pyrophosphate Synthase Complex With An Isopentenyl Pyrophosphate Length = 323 Back     alignment and structure
>pdb|2AZL|A Chain A, Crystal Structure For The Mutant F117e Of Thermotoga Maritima Octaprenyl Pyrophosphate Synthase Length = 299 Back     alignment and structure
>pdb|1RQJ|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Risedronate Length = 299 Back     alignment and structure
>pdb|1RQI|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Dimethylallyl S- Thiolodiphosphate Length = 300 Back     alignment and structure
>pdb|4DHD|A Chain A, Crystal Structure Of Isoprenoid Synthase A3msh1 (Target Efi-501992) From Pyrobaculum Calidifontis Length = 358 Back     alignment and structure
>pdb|1VG7|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123AD62A MUTANT Length = 299 Back     alignment and structure
>pdb|1V4K|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima S77f Mutant Length = 299 Back     alignment and structure
>pdb|3UCA|A Chain A, Crystal Structure Of Isoprenoid Synthase (Target Efi-501974) From Clostridium Perfringens Length = 324 Back     alignment and structure
>pdb|1WKZ|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima K41a Mutant Length = 299 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 7e-69
2q80_A 301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 4e-39
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltra 3e-63
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltra 1e-34
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 3e-42
2her_A 368 Fragment, farnesyl pyrophosphate synthase; farnesy 2e-24
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, preny 1e-17
1wmw_A 330 Geranylgeranyl diphosphate synthetase; GGPP, preny 2e-10
4dhd_A358 Polyprenyl synthetase; isoprenoid synthesis, isopr 2e-14
4dhd_A 358 Polyprenyl synthetase; isoprenoid synthesis, isopr 1e-07
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosph 3e-14
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosph 9e-08
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 2e-12
2azj_A 289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 9e-06
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 2e-12
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 1e-05
2ihi_A395 Pyrophosphate synthase; PV092040, structural genom 4e-12
2ihi_A 395 Pyrophosphate synthase; PV092040, structural genom 3e-04
4fp4_A285 Polyprenyl synthetase; isoprenoid synthesis, isopr 1e-11
4fp4_A 285 Polyprenyl synthetase; isoprenoid synthesis, isopr 2e-04
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltra 1e-11
2qis_A 374 Farnesyl pyrophosphate synthetase; trans-prenyltra 7e-06
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural 2e-11
3lk5_A 380 Geranylgeranyl pyrophosphate synthase; structural 2e-05
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, i 1e-10
1uby_A 367 FPS, farnesyl diphosphate synthase; transferase, i 1e-04
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 2e-10
3apz_A348 Geranyl diphosphate synthase; prenyltransferase, a 2e-10
3apz_A 348 Geranyl diphosphate synthase; prenyltransferase, a 4e-05
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosph 2e-10
3dyh_A 390 Farnesyl pyrophosphate synthase; protein-bisphosph 4e-05
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 3e-10
3ipi_A 295 Geranyltranstransferase; isoprene biosynthesis, he 1e-04
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 1e-09
3aqb_B325 Component B of hexaprenyl diphosphate synthase; pr 1e-09
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosph 3e-09
1yhl_A 362 Farnesyl pyrophosphate synthase; farnesyl diphosph 5e-04
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 4e-09
1v4e_A 299 Octoprenyl-diphosphate synthase; trans-type prenyl 5e-04
3mzv_A341 Decaprenyl diphosphate synthase; transferase, stru 5e-09
3rmg_A334 Octaprenyl-diphosphate synthase; structural genomi 6e-09
3pko_A334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 7e-09
3tc1_A315 Octaprenyl pyrophosphate synthase; all alpha-helic 8e-09
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 1e-06
2h8o_A335 Geranyltranstransferase; geranyltransferase,agroba 4e-06
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 6e-06
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, struc 7e-06
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl 7e-06
4f62_A317 Geranyltranstransferase; enzyme function initiativ 1e-05
3ts7_A324 Geranyltranstransferase; isoprenoid synthesis, far 1e-05
3uca_A324 Geranyltranstransferase; isoprenoid synthesis, iso 1e-05
3qkc_B273 Geranyl diphosphate synthase small subunit; struct 2e-05
3lsn_A304 Geranyltranstransferase; structural genomics, prot 2e-05
3lom_A313 Geranyltranstransferase; geranyltransferase, struc 2e-05
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aur 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3kra_B274 Geranyl diphosphate synthase small subunit; prenyl 1e-04
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transfera 2e-04
3llw_A311 Geranyltranstransferase (ISPA); structural genomic 3e-04
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SG 4e-04
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphospha 5e-04
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
 Score =  213 bits (544), Expect = 7e-69
 Identities = 93/145 (64%), Positives = 118/145 (81%)

Query: 9   EQDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDI 68
                LL+PY Y+ Q+PGKQ+RTKL+ AFN+WL +PE+KL  I ++ +MLHN+SLLIDDI
Sbjct: 8   TVQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDI 67

Query: 69  EDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQ 128
           EDNS LRRG PVAHSIYGI S IN+ANYV  + LEKV +L HP+A  ++T QLLELH+GQ
Sbjct: 68  EDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQ 127

Query: 129 GMEIYWRDNYTCPSEEEYRTMTIRK 153
           G++IYWRDNYTCP+EEEY+ M ++K
Sbjct: 128 GLDIYWRDNYTCPTEEEYKAMVLQK 152
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Length = 340 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Length = 340 Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Length = 330 Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Length = 330 Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} Length = 358 Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} Length = 358 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Length = 352 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Length = 352 Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Length = 289 Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Length = 289 Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Length = 342 Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Length = 342 Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Length = 285 Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Length = 285 Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Length = 374 Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Length = 374 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Length = 380 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Length = 380 Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Length = 284 Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Length = 348 Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Length = 348 Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Length = 390 Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Length = 390 Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Length = 295 Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Length = 295 Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Length = 345 Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Length = 325 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Length = 362 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Length = 362 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Length = 299 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Length = 299 Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Length = 341 Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Length = 334 Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Length = 334 Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Length = 315 Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Length = 360 Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Length = 335 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Length = 297 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Length = 302 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Length = 299 Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Length = 317 Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Length = 324 Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Length = 324 Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Length = 273 Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Length = 304 Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Length = 313 Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Length = 274 Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Length = 293 Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Length = 311 Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Length = 291 Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
3lsn_A304 Geranyltranstransferase; structural genomics, prot 100.0
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 100.0
3mzv_A341 Decaprenyl diphosphate synthase; transferase, stru 100.0
3rmg_A334 Octaprenyl-diphosphate synthase; structural genomi 100.0
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 100.0
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 100.0
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, struc 100.0
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphospha 100.0
3ts7_A324 Geranyltranstransferase; isoprenoid synthesis, far 100.0
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aur 100.0
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 100.0
3uca_A324 Geranyltranstransferase; isoprenoid synthesis, iso 100.0
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 100.0
3aqb_B325 Component B of hexaprenyl diphosphate synthase; pr 100.0
4f62_A317 Geranyltranstransferase; enzyme function initiativ 100.0
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 100.0
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, struc 100.0
3kra_B274 Geranyl diphosphate synthase small subunit; prenyl 100.0
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosph 100.0
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 100.0
2h8o_A335 Geranyltranstransferase; geranyltransferase,agroba 100.0
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl 100.0
4dhd_A358 Polyprenyl synthetase; isoprenoid synthesis, isopr 100.0
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltra 100.0
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, preny 100.0
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 100.0
3pko_A334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 100.0
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SG 100.0
3llw_A311 Geranyltranstransferase (ISPA); structural genomic 100.0
3lom_A313 Geranyltranstransferase; geranyltransferase, struc 100.0
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 100.0
3apz_A348 Geranyl diphosphate synthase; prenyltransferase, a 100.0
3qkc_B273 Geranyl diphosphate synthase small subunit; struct 100.0
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transfera 100.0
4fp4_A285 Polyprenyl synthetase; isoprenoid synthesis, isopr 100.0
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural 100.0
3tc1_A315 Octaprenyl pyrophosphate synthase; all alpha-helic 100.0
2q58_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 100.0
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltra 100.0
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, i 100.0
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosph 100.0
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 100.0
2ihi_A395 Pyrophosphate synthase; PV092040, structural genom 100.0
3mav_A395 Farnesyl pyrophosphate synthase; PV092040, structu 100.0
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosph 100.0
2q80_A 301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 99.72
2e8v_A 340 Geranylgeranyl pyrophosphate synthetase; prenyltra 99.71
1v4e_A 299 Octoprenyl-diphosphate synthase; trans-type prenyl 99.71
3mzv_A 341 Decaprenyl diphosphate synthase; transferase, stru 99.71
3oyr_A 345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 99.71
1wy0_A 342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 99.7
3rmg_A 334 Octaprenyl-diphosphate synthase; structural genomi 99.7
3aqb_B 325 Component B of hexaprenyl diphosphate synthase; pr 99.7
3tc1_A 315 Octaprenyl pyrophosphate synthase; all alpha-helic 99.69
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosph 99.69
2ftz_A 284 Geranyltranstransferase; TM0161, structural GE joi 99.69
1wmw_A 330 Geranylgeranyl diphosphate synthetase; GGPP, preny 99.68
3apz_A 348 Geranyl diphosphate synthase; prenyltransferase, a 99.67
3pko_A 334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 99.67
3lmd_A 360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 99.67
4dhd_A 358 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.66
3ipi_A 295 Geranyltranstransferase; isoprene biosynthesis, he 99.65
1rtr_A 301 Geranyltranstransferase; 2.50A {Staphylococcus aur 99.63
3m0g_A 297 Farnesyl diphosphate synthase; structural genomics 99.63
2q58_A 368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.62
3pde_A 309 Farnesyl-diphosphate synthase; isoprenyl diphospha 99.62
2h8o_A 335 Geranyltranstransferase; geranyltransferase,agroba 99.62
3p8l_A 302 Geranyltranstransferase; isoprenyl synthase, struc 99.61
1rqj_A 299 Geranyltranstransferase; bisphosphonate, isoprenyl 99.61
3ts7_A 324 Geranyltranstransferase; isoprenoid synthesis, far 99.6
1yhl_A 362 Farnesyl pyrophosphate synthase; farnesyl diphosph 99.6
3npk_A 291 Geranyltranstransferase; isoprene biosynthesis, SG 99.6
3lk5_A 380 Geranylgeranyl pyrophosphate synthase; structural 99.59
3kra_B274 Geranyl diphosphate synthase small subunit; prenyl 99.59
3lsn_A 304 Geranyltranstransferase; structural genomics, prot 99.58
2azj_A 289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 99.58
3lom_A 313 Geranyltranstransferase; geranyltransferase, struc 99.58
3llw_A 311 Geranyltranstransferase (ISPA); structural genomic 99.58
3p8r_A 302 Geranyltranstransferase; isoprenyl synthase, struc 99.58
4f62_A 317 Geranyltranstransferase; enzyme function initiativ 99.57
3uca_A 324 Geranyltranstransferase; isoprenoid synthesis, iso 99.57
2qis_A 374 Farnesyl pyrophosphate synthetase; trans-prenyltra 99.54
2her_A 368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.54
1uby_A 367 FPS, farnesyl diphosphate synthase; transferase, i 99.53
3mav_A 395 Farnesyl pyrophosphate synthase; PV092040, structu 99.53
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transfera 99.51
4fp4_A 285 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.5
2ihi_A 395 Pyrophosphate synthase; PV092040, structural genom 99.46
3dyh_A 390 Farnesyl pyrophosphate synthase; protein-bisphosph 99.45
3qkc_B273 Geranyl diphosphate synthase small subunit; struct 99.41
1ps1_A337 Pentalenene synthase; antibiotic biosynthesis, ses 83.71
3kb9_A382 EPI-isozizaene synthase; terpenoid cyclase, alpha- 82.27
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-43  Score=311.98  Aligned_cols=191  Identities=23%  Similarity=0.274  Sum_probs=165.7

Q ss_pred             chhHHhHHHHhhcCCCcchHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHhhhc--cCCCCCCCCCCchhhhcchh
Q psy3879          11 DEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDI--EDNSILRRGIPVAHSIYGIA   88 (247)
Q Consensus        11 ~~~l~~~~~y~~~~~GK~~R~~l~~~~~~~~~~~~~~~~~~a~avElih~asLihDDI--~D~s~~RRG~p~~h~~~G~~   88 (247)
                      ++.+.++++|++..||||+||.|++++++++|++.+.+..+|+++||||++|||||||  ||+|++|||+||+|++||++
T Consensus        29 ~~~l~~~~~y~~~~gGKrlRp~L~l~~~~~~g~~~~~~~~~A~aiEliH~asLIHDDip~mD~s~~RRG~pt~h~~~G~~  108 (304)
T 3lsn_A           29 LARLYEAMRYSVMNGGKRVRPLLAYAACEALGGKPEQANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHKAFDEA  108 (304)
T ss_dssp             GHHHHHHHHHHHTTTCCCHHHHHHHHHHHHTTCCGGGGHHHHHHHHHHHHHHHHHHTSTTTTCCSEETTEECHHHHSCHH
T ss_pred             cHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHCCcccccCCCccCCCCchHhhcCHH
Confidence            6899999999999999999999999999999999999999999999999999999999  99999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhcC----Ch----HHHHHHHHHH--HHhHhhhhhhhhhccCCCCCCHHHHHHHhHHhhhhhh
Q psy3879          89 STINAANYVVAIALEKVQSLG----HP----EATAVYTEQL--LELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRI  158 (247)
Q Consensus        89 ~Ai~~gd~l~~~~~~~l~~~~----~~----~~~~~~~~~~--~~~~~Gq~~dl~~~~~~~~~s~~~Y~~ii~~Kt~~~~  158 (247)
                      .|||+||+|++.+|+.+++.+    .+    ++++.+++++  .+++.||.+|+.+..+  .+++++|++|+.+|||.++
T Consensus       109 ~AIlaGD~Ll~~a~~~l~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~GQ~lDl~~~~~--~~s~~~y~~i~~~KTg~L~  186 (304)
T 3lsn_A          109 CAILAGDGLQSLAFSALLDPALSDASAEIRLRMVTTLAQAAGPAGMVGGQAIDLGSVGL--KLDQQALEYMHRHKTGALI  186 (304)
T ss_dssp             HHHHHHHHHHHHHHHHHHCTTSCCCCHHHHHHHHHHHHHHHSTTTHHHHHHHHHHTTTC--CCCHHHHHHHHHHHTHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcccCCChHHHHHHHHHHHHHHchhhHhHhHHHHHHccCC--CCCHHHHHHHHHhhhHHHH
Confidence            999999999999999999874    23    3667777777  4599999999998875  4899999999999999987


Q ss_pred             ------------------------------------ccccc------------chhhhcCCCchhhhhcHHHHHHHHHHH
Q psy3879         159 ------------------------------------DDIED------------NSILRRGIPVAHSIYGIASTINAANYV  190 (247)
Q Consensus       159 ------------------------------------dd~~d------------~~~lr~g~~t~~~~~g~~~ai~~~~~l  190 (247)
                                                          ||++|            ++|++.||+|++.++|++.|......+
T Consensus       187 ~~~~~~ga~lag~~~~~~~~~l~~~g~~lGlaFQI~DDilD~~~~~~~~GK~~g~Dl~egK~T~p~l~~l~~a~~~a~~~  266 (304)
T 3lsn_A          187 EASVILGALASGRAEKGELKALQTYAQAIGLAFQVQDDILDVESDTATLGKRQGADIARDKPTYPALLGLAAAKEYALEL  266 (304)
T ss_dssp             HHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------------CCHHHHHCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCChHHhCCCcccHHhcCCccHHHHHHHHHHHHHHHHH
Confidence                                                77776            357888888888888888888888888


Q ss_pred             HHHHHHHHhcCCC
Q psy3879         191 VAIALEKVQSLGH  203 (247)
Q Consensus       191 ~~~a~q~~~~l~~  203 (247)
                      +..|.+.+..++.
T Consensus       267 ~~~A~~~L~~l~~  279 (304)
T 3lsn_A          267 RDQALHALRPFDA  279 (304)
T ss_dssp             HHHHHHHTTTSCG
T ss_pred             HHHHHHHHHhCch
Confidence            8888888888764
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} SCOP: a.128.1.1 Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} PDB: 4gp1_A* 4gp2_A* Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Back     alignment and structure
>2q58_A Fragment, farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, structural genomics, structur genomics consortium, SGC; HET: ZOL; 2.37A {Cryptosporidium parvum} PDB: 2o1o_A* Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Back     alignment and structure
>3mav_A Farnesyl pyrophosphate synthase; PV092040, structural genomics, structural genomics consortium, SGC, transferase, isoprene biosynthesis; 2.10A {Plasmodium vivax} PDB: 3cc9_A* 3ez3_A* 3ldw_A* 3mys_A* 3ph7_A* 3rbm_A* 3ryw_A* Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} PDB: 4gp1_A* 4gp2_A* Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>2q58_A Fragment, farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, structural genomics, structur genomics consortium, SGC; HET: ZOL; 2.37A {Cryptosporidium parvum} PDB: 2o1o_A* Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} SCOP: a.128.1.1 Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>3mav_A Farnesyl pyrophosphate synthase; PV092040, structural genomics, structural genomics consortium, SGC, transferase, isoprene biosynthesis; 2.10A {Plasmodium vivax} PDB: 3cc9_A* 3ez3_A* 3ldw_A* 3mys_A* 3ph7_A* 3rbm_A* 3ryw_A* Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Back     alignment and structure
>1ps1_A Pentalenene synthase; antibiotic biosynthesis, sesquiterpene cyclase, lyase; 2.60A {Streptomyces SP} SCOP: a.128.1.4 PDB: 1hm7_A 1hm4_A Back     alignment and structure
>3kb9_A EPI-isozizaene synthase; terpenoid cyclase, alpha-helical fold, farnesyl diphosphate, metal-binding, lyase, magnesium; HET: BTM; 1.60A {Streptomyces coelicolor} PDB: 3kbk_A 3lgk_A 3lg5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 247
d2q80a1291 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate s 4e-22
d1rqja_299 a.128.1.1 (A:) Farnesyl diphosphate synthase (gera 1e-12
d1rtra_290 a.128.1.1 (A:) Farnesyl diphosphate synthase (gera 3e-09
d1fpsa_348 a.128.1.1 (A:) Farnesyl diphosphate synthase (gera 4e-04
d1v4ea_280 a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Th 0.004
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Length = 291 Back     information, alignment and structure

class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Isoprenyl diphosphate synthases
domain: Geranylgeranyl pyrophosphate synthetase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 90.1 bits (222), Expect = 4e-22
 Identities = 94/147 (63%), Positives = 121/147 (82%), Gaps = 1/147 (0%)

Query: 9   EQDEK-LLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDD 67
           E  ++ LL+PY Y+ Q+PGKQ+RTKL+ AFN+WL +PE+KL  I ++ +MLHN+SLLIDD
Sbjct: 1   ETVQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDD 60

Query: 68  IEDNSILRRGIPVAHSIYGIASTINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRG 127
           IEDNS LRRG PVAHSIYGI S IN+ANYV  + LEKV +L HP+A  ++T QLLELH+G
Sbjct: 61  IEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQG 120

Query: 128 QGMEIYWRDNYTCPSEEEYRTMTIRKF 154
           QG++IYWRDNYTCP+EEEY+ M ++K 
Sbjct: 121 QGLDIYWRDNYTCPTEEEYKAMVLQKT 147
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} Length = 299 Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Length = 290 Back     information, alignment and structure
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Length = 348 Back     information, alignment and structure
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Length = 280 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
d2q80a1291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 100.0
d1rqja_299 Farnesyl diphosphate synthase (geranyltranstransfe 100.0
d1rtra_290 Farnesyl diphosphate synthase (geranyltranstransfe 100.0
d1v4ea_280 Octoprenyl-diphosphate synthase {Thermotoga mariti 100.0
d1fpsa_348 Farnesyl diphosphate synthase (geranyltranstransfe 100.0
d2q80a1 291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 99.65
d1v4ea_ 280 Octoprenyl-diphosphate synthase {Thermotoga mariti 99.56
d1fpsa_ 348 Farnesyl diphosphate synthase (geranyltranstransfe 99.47
d1rqja_ 299 Farnesyl diphosphate synthase (geranyltranstransfe 99.4
d1rtra_ 290 Farnesyl diphosphate synthase (geranyltranstransfe 99.23
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Isoprenyl diphosphate synthases
domain: Geranylgeranyl pyrophosphate synthetase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.9e-43  Score=305.48  Aligned_cols=173  Identities=58%  Similarity=0.944  Sum_probs=161.6

Q ss_pred             cchhHHhHHHHhhcCCCcchHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCchhhhcchhH
Q psy3879          10 QDEKLLQPYTYISQVPGKQIRTKLAYAFNNWLNIPEEKLLAIGDIIQMLHNSSLLIDDIEDNSILRRGIPVAHSIYGIAS   89 (247)
Q Consensus        10 ~~~~l~~~~~y~~~~~GK~~R~~l~~~~~~~~~~~~~~~~~~a~avElih~asLihDDI~D~s~~RRG~p~~h~~~G~~~   89 (247)
                      .++.+.+|++|++..||||+||.|+++++++++++.+.+..+|+++|+||+||||||||||+|++|||+||+|++||++.
T Consensus         3 ~~~~l~e~~~y~~~~gGKr~Rp~l~~~~~~~~~~~~~~~~~~a~aiEllH~asLihDDi~D~~~~RRg~pt~~~~~G~~~   82 (291)
T d2q80a1           3 VQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPS   82 (291)
T ss_dssp             HHHHHTHHHHHHTTSSCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTCSEETTEECHHHHHCHHH
T ss_pred             hhHHHHHHHHHHHhCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHhcccccCcccccCCCccccccchhh
Confidence            35778999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHhHhhhhhhhhhccCCCCCCHHHHHHHhHHhhhhhh-----------
Q psy3879          90 TINAANYVVAIALEKVQSLGHPEATAVYTEQLLELHRGQGMEIYWRDNYTCPSEEEYRTMTIRKFDMRI-----------  158 (247)
Q Consensus        90 Ai~~gd~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~Gq~~dl~~~~~~~~~s~~~Y~~ii~~Kt~~~~-----------  158 (247)
                      ||++||+|++++++.+.+.+++.+.+.+++.+.+++.||.+|+.+..+...+++++|++|+.+|||.++           
T Consensus        83 Ail~gd~l~~~a~~~l~~~~~~~~~~~~~~~~~~~~~gq~~d~~~~~~~~~~s~~~y~~ii~~KT~~Lf~~~~~~ga~~~  162 (291)
T d2q80a1          83 VINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFS  162 (291)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCTTHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             hhhHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHhHhccccccccccccccCCHHHHHHHHHhccchhhHhhhhhhhhhc
Confidence            999999999999999999988999999999999999999999998877656899999999999999987           


Q ss_pred             --------------------ccccc------------chhhhcCCCchhhhhcHHH
Q psy3879         159 --------------------DDIED------------NSILRRGIPVAHSIYGIAS  182 (247)
Q Consensus       159 --------------------dd~~d------------~~~lr~g~~t~~~~~g~~~  182 (247)
                                          ||++|            ++|++.|++|+|.++..+.
T Consensus       163 ~~~~~l~~~g~~lG~afQi~DD~ld~~~~~~~~GK~~g~Dl~~gK~Tlpvi~al~~  218 (291)
T d2q80a1         163 DYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWS  218 (291)
T ss_dssp             CCCSCCHHHHHHHHHHHHHHHHHHHHHCC------CTTHHHHHTCCCHHHHHHHHH
T ss_pred             ccchhhHHHHHHHHHHHHHHHHhhhhccchhhccccccchhccCCCcHHHHHHHHh
Confidence                                77776            2689999999999887653
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure