Diaphorina citri psyllid: psy3910


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIVQPKSPYEQ
ccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHcHHHHcccHHHHHHHHHcccccccccccccccccHHHHHccccccccccccccccHHHHHHcccccHHHHHHHccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccCECccccccccccccccHHHHHHHcccccccccEEEEcccccccccccHHHHHHHHHHcccEEECcccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHcccccccccccc
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIV*P******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIVQPKSPYEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0003674 [MF]molecular_functionprobable
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 1-166
View the alignment between query and template
View the model in PyMOL
Template: 2NTE, chain A
Confidence level:very confident
Coverage over the Query: 120-344
View the alignment between query and template
View the model in PyMOL