Psyllid ID: psy3910

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIVQPKSPYEQ
ccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHcHHHHcccHHHHHHHHHcccccccccccccccccHHHHHccccccccccccccccHHHHHHcccccHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccccHHHHHHHHHccccccccEEEEcccccccccccHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHcccccccccccc
ccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHcccccEEEEEEEccccccEEEccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHcccccccccccccccccccHHHHHcccccccccEEEEcccccccccccHHHHHHHHHHcccEEEccccccccccccccEEEEccccccccccccEEEEEEccccccHHHHccccEEEccHHHHHHHHHHcccccccccccc
mnpnvkdnagwtplhdavsIGNESVVRLLLEAGalvnvpgldndtplhlaARDVRPALAKLLIQYGadvdkrniqghkpleyldvisrddiktdiltalslprlsaapppslpncidIVIYADQLDKTQTSGLAQFVKTlssgadvpIIVSTLLQSNVNIllvngtpertcIATCNVLRAILSGIKAVDYTWISRSleigkvlpveefeilgtvdyplakpfhrsrenkenllpgLFNGLqvyltkpwptssplsseDMRDIFKRGgatllnrepdpesmnlsessvmyhvnrpqhrlynlsqAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFeivqpkspyeq
mnpnvkdnagwtplhdAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGadvdkrniqghKPLEYLDVISRDDIKTDILTALSlprlsaapppsLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGatllnrepdpesmnLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEivqpkspyeq
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDIltalslprlsaapppslpNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIVQPKSPYEQ
*********GWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPW***************************************MYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIV********
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAA****LPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGT*****************NLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIV*P******
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIV********
*NP**KDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIVQPKS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCIDIVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPESMNLSESSVMYHVNRPQHRLYNLSQAIVYSEEALPRRLYNMEHVKALGLSWVRACVEQFEIVQPKSPYEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query348 2.2.26 [Sep-21-2011]
Q99728777 BRCA1-associated RING dom yes N/A 0.899 0.402 0.317 4e-30
Q9QZH2768 BRCA1-associated RING dom yes N/A 0.902 0.408 0.282 3e-28
O70445765 BRCA1-associated RING dom yes N/A 0.890 0.405 0.285 5e-28
Q6UB98 2062 Ankyrin repeat domain-con no N/A 0.229 0.038 0.462 2e-14
Q6UB99 2663 Ankyrin repeat domain-con no N/A 0.215 0.028 0.5 1e-13
Q9H2K2 1166 Tankyrase-2 OS=Homo sapie no N/A 0.327 0.097 0.368 4e-12
Q3UES3 1166 Tankyrase-2 OS=Mus muscul no N/A 0.327 0.097 0.368 4e-12
Q0P5G1 1374 Tonsoku-like protein OS=B no N/A 0.229 0.058 0.469 2e-11
Q59H18 835 Serine/threonine-protein no N/A 0.278 0.116 0.414 2e-11
Q5RF15 618 Serine/threonine-protein no N/A 0.258 0.145 0.434 2e-11
>sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 Back     alignment and function desciption
 Score =  132 bits (332), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 166/347 (47%), Gaps = 34/347 (9%)

Query: 2   NPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKL 61
           +PNVKD+AGWTPLH+A + G+  VV LLL+  ALVN  G  ND+PLH AA++    + KL
Sbjct: 453 DPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKL 512

Query: 62  LIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDILTALSLPRLSAAPPPSLPNCID---- 117
           L+ YGA  +  NI G +P++Y D    D+    +L        S+A   S+ N       
Sbjct: 513 LLSYGASRNAVNIFGLRPVDYTD----DESMKSLLLLPEKNESSSASHCSVMNTGQRRDG 568

Query: 118 -IVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCN 176
            +V+    L   Q   L++    L +         T   S V  ++V G   ++   T  
Sbjct: 569 PLVLIGSGLSSEQQKMLSELAVILKAKK------YTEFDSTVTHVVVPGDAVQS---TLK 619

Query: 177 VLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGL 236
            +  IL+G   + + W+   L   KV   EE        Y + +   RSR N+E LLP L
Sbjct: 620 CMLGILNGCWILKFEWVKACLR-RKVCEQEE-------KYEIPEGPRRSRLNREQLLPKL 671

Query: 237 FNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPES-MNLSESSVMYHVNRPQ 295
           F+G   YL   W T      +++  +   GG  +L+R+P P+S +  + ++V YH  RP 
Sbjct: 672 FDGCYFYL---WGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHA-RPD 727

Query: 296 HRLYNLSQAIVYSE--EALPRRLYNMEHVKALGLSWVRACVEQFEIV 340
                 +Q I+Y +     P R+   +  KA   SW   CV  FE++
Sbjct: 728 SDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPS-SWFIDCVMSFELL 773
Probable E3 ubiquitin-protein ligase. The BRCA1-BARD1 heterodimer specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Plays a central role in the control of the cell cycle in response to DNA damage. Acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. Also forms a heterodimer with CSTF1/CSTF-50 to modulate mRNA processing and RNAP II stability by inhibiting pre-mRNA 3' cleavage.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 Back     alignment and function description
>sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 Back     alignment and function description
>sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 Back     alignment and function description
>sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 Back     alignment and function description
>sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 Back     alignment and function description
>sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 Back     alignment and function description
>sp|Q0P5G1|TONSL_BOVIN Tonsoku-like protein OS=Bos taurus GN=TONSL PE=2 SV=1 Back     alignment and function description
>sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 Back     alignment and function description
>sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query348
340720549 508 PREDICTED: BRCA1-associated RING domain 0.945 0.647 0.326 1e-39
350414920 506 PREDICTED: BRCA1-associated RING domain 0.945 0.650 0.324 2e-39
383860223 521 PREDICTED: BRCA1-associated RING domain 0.956 0.639 0.320 3e-39
321470971 534 hypothetical protein DAPPUDRAFT_102038 [ 0.936 0.610 0.343 9e-37
357616488 535 putative BRCA1-associated RING domain pr 0.939 0.611 0.323 1e-36
380028816 471 PREDICTED: BRCA1-associated RING domain 0.951 0.702 0.297 7e-36
328783552 508 PREDICTED: BRCA1-associated RING domain 0.954 0.653 0.299 3e-35
405958102 570 BRCA1-associated RING domain protein 1 [ 0.913 0.557 0.308 9e-34
242011367 557 BRCA1-associated RING domain protein, pu 0.867 0.542 0.290 1e-32
301604800 757 PREDICTED: BRCA1-associated RING domain 0.902 0.414 0.299 8e-31
>gi|340720549|ref|XP_003398697.1| PREDICTED: BRCA1-associated RING domain protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  170 bits (430), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/358 (32%), Positives = 186/358 (51%), Gaps = 29/358 (8%)

Query: 2   NPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKL 61
           NPN KD  GWTPL + VS G+ ++ +LLLE GAL N PG  N T LH AA+  R   AK+
Sbjct: 155 NPNTKDYNGWTPLQEVVSYGHTNICQLLLECGALPNTPGEGNRTALHEAAKANRLLEAKM 214

Query: 62  LIQYGADVDKRNIQGHKPLEYLDVIS------RDDIKTDILTALSLPRLSAAPPPSLPNC 115
           L++Y A+ +  +  G KP++Y    S      +D+ + D +   ++  LS     SL   
Sbjct: 215 LLKYSANKNVYDDYGRKPIDYCQPYSEMWNILKDENELDNVLETTID-LSHTLNKSLSMT 273

Query: 116 ID-IVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIAT 174
            + +VIY   L +     L +    ++S   + I+  +  QS+V  ++V    E     +
Sbjct: 274 FNMVVIYVSDLQEENKRHLNE----IASKNKIKIV--SRFQSSVTHVIVEANSENVVQLS 327

Query: 175 CNVLRAILSGIKAVDYTWISRSLEIGKVLP--VEEFEILGTVDYPLAKPFHRSRENKENL 232
            +V+ A+L G   ++  WI   ++I ++L   +E FE+ GT   P+     ++REN +  
Sbjct: 328 YDVMMALLHGAWLLNTEWIQLGMDISEILKGDLEIFEVSGT---PIKGIPKKARENAQKQ 384

Query: 233 LPGLFNGLQVYLTKPWPTSS------PLSSEDMRDIFKRGGATLLNREPDPESMNLSESS 286
            PGLFN  + Y    W + +       L+ E +  + + GG T+L REP+PE++      
Sbjct: 385 NPGLFN--RCYFYFAWQSKNIYANGMQLTKEALIALVQEGGGTVLKREPNPENIKDQGLF 442

Query: 287 VMYHV-NRPQHRLYNLSQAIVYS-EEALPRRLYNMEHVKALGLSWVRACVEQFEIVQP 342
           + +HV N P H LY  +  I+Y  E   PR  YNM H+K L L W+  C+E+F ++ P
Sbjct: 443 IPFHVANEPTHSLYKCTHYIIYVPERDEPRIKYNMPHIKTLPLIWLIECIEKFTLIDP 500

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350414920|ref|XP_003490470.1| PREDICTED: BRCA1-associated RING domain protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383860223|ref|XP_003705590.1| PREDICTED: BRCA1-associated RING domain protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|321470971|gb|EFX81945.1| hypothetical protein DAPPUDRAFT_102038 [Daphnia pulex] Back     alignment and taxonomy information
>gi|357616488|gb|EHJ70219.1| putative BRCA1-associated RING domain protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|380028816|ref|XP_003698082.1| PREDICTED: BRCA1-associated RING domain protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|328783552|ref|XP_001120441.2| PREDICTED: BRCA1-associated RING domain protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|405958102|gb|EKC24263.1| BRCA1-associated RING domain protein 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|242011367|ref|XP_002426424.1| BRCA1-associated RING domain protein, putative [Pediculus humanus corporis] gi|212510523|gb|EEB13686.1| BRCA1-associated RING domain protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|301604800|ref|XP_002932040.1| PREDICTED: BRCA1-associated RING domain protein 1-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query348
UNIPROTKB|Q90X95772 bard1 "BRCA1-associated RING d 0.910 0.410 0.285 2.2e-29
UNIPROTKB|F1P8X2728 BARD1 "Uncharacterized protein 0.238 0.114 0.542 2.2e-26
UNIPROTKB|Q5ZKJ1750 BARD1 "Uncharacterized protein 0.238 0.110 0.506 2.2e-26
MGI|MGI:1328361765 Bard1 "BRCA1 associated RING d 0.238 0.108 0.506 1.2e-25
RGD|621072768 Bard1 "BRCA1 associated RING d 0.238 0.108 0.493 2.3e-25
UNIPROTKB|G3V7X7768 Bard1 "BRCA1 associated RING d 0.238 0.108 0.493 2.3e-25
UNIPROTKB|F1SSQ2780 BARD1 "Uncharacterized protein 0.238 0.106 0.518 1.1e-24
UNIPROTKB|F1MAV4772 LOC100848694 "Uncharacterized 0.238 0.107 0.506 1.3e-24
UNIPROTKB|Q99728777 BARD1 "BRCA1-associated RING d 0.646 0.289 0.322 1.5e-20
RGD|1310118345 Ankrd12 "ankyrin repeat domain 0.224 0.226 0.461 1.3e-12
UNIPROTKB|Q90X95 bard1 "BRCA1-associated RING domain protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 335 (123.0 bits), Expect = 2.2e-29, P = 2.2e-29
 Identities = 99/347 (28%), Positives = 162/347 (46%)

Query:     2 NPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKL 61
             NPNVKDNAGWTPLH+A ++G+  VV+LLL+  AL+N  G  NDTPLH A ++   A+ KL
Sbjct:   445 NPNVKDNAGWTPLHEACNLGHTMVVQLLLQHHALMNTTGYQNDTPLHDAVKNGHIAIVKL 504

Query:    62 LIQYGADVDKRNIQGHKPLEYLDVISRDDIKTDIXXXXXXXXXXXXXXXXXXNCID---- 117
             L+ +GA  D  NI G +P++Y +      +  +                   +       
Sbjct:   505 LLSHGASRDAVNIFGLQPVDYAETEEMKSVLLETQTERDRLLLHPCLAAPQLSSHQRKEE 564

Query:   118 -IVIYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCN 176
              +V+ A  L  TQ + L +  K L +       +     S V  ++V+  P    + T  
Sbjct:   565 AVVLIASGLLATQRADLTKLAKMLKAS------ICAEYDSTVTHVIVSDEP---VLRTMK 615

Query:   177 VLRAILSGIKAVDYTWISRSLEIGKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGL 236
              +  IL+G   + ++W+   L+     P E +EI      P   P HR+R N + +LP L
Sbjct:   616 CMMGILAGCWTLQFSWVKACLQSCNREPEESYEI------PHG-P-HRARLNGQQMLPQL 667

Query:   237 FNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPES-MNLSESSVMYHVNRPQ 295
              +G   Y    +        ED+ ++ K  G  +L R+P P+S +  + ++V YH     
Sbjct:   668 LDGCHFYFLGCFTEHR---KEDLIELVKAAGGQILIRQPKPDSDVTQTINTVAYHAEADS 724

Query:   296 HRLYNLSQAIVYSEEAL--PRRLYNMEHVKALGLSWVRACVEQFEIV 340
              + +  +Q IV+   +   P R+     V     SW+  C+  F+++
Sbjct:   725 DQRF-CTQYIVFDRASKYRPERV-RQGKVWFAPSSWIIECITSFQLL 769
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|F1P8X2 BARD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKJ1 BARD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1328361 Bard1 "BRCA1 associated RING domain 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621072 Bard1 "BRCA1 associated RING domain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V7X7 Bard1 "BRCA1 associated RING domain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSQ2 BARD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAV4 LOC100848694 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q99728 BARD1 "BRCA1-associated RING domain protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310118 Ankrd12 "ankyrin repeat domain 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-14
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-11
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-10
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-07
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-05
smart0024830 smart00248, ANK, ankyrin repeats 7e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 2e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-04
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 2e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 5e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.002
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.003
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.004
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 92.1 bits (229), Expect = 7e-23
 Identities = 40/81 (49%), Positives = 52/81 (64%)

Query: 2   NPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKL 61
           + N KDN G TPLH A   G+  +V+LLLE GA VN    D +TPLHLAAR+    + KL
Sbjct: 32  DVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARDKDGNTPLHLAARNGNLDVVKL 91

Query: 62  LIQYGADVDKRNIQGHKPLEY 82
           L+++GADV+ R+  G  PL  
Sbjct: 92  LLKHGADVNARDKDGRTPLHL 112

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 348
KOG4412|consensus226 99.96
KOG4412|consensus226 99.94
KOG0509|consensus 600 99.92
PHA02791284 ankyrin-like protein; Provisional 99.92
PHA02791284 ankyrin-like protein; Provisional 99.91
PHA02874434 ankyrin repeat protein; Provisional 99.9
PHA02946446 ankyin-like protein; Provisional 99.89
KOG0509|consensus 600 99.89
KOG4362|consensus684 99.88
PHA02878477 ankyrin repeat protein; Provisional 99.88
PHA03100480 ankyrin repeat protein; Provisional 99.88
PHA02859209 ankyrin repeat protein; Provisional 99.87
PHA02798489 ankyrin-like protein; Provisional 99.87
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.87
PHA02875413 ankyrin repeat protein; Provisional 99.87
PHA02989494 ankyrin repeat protein; Provisional 99.87
KOG0502|consensus296 99.86
PHA03095471 ankyrin-like protein; Provisional 99.86
PHA03095471 ankyrin-like protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0510|consensus 929 99.86
KOG0512|consensus228 99.86
PHA02741169 hypothetical protein; Provisional 99.85
PHA02878477 ankyrin repeat protein; Provisional 99.85
PHA02875413 ankyrin repeat protein; Provisional 99.85
PHA02874434 ankyrin repeat protein; Provisional 99.85
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.84
KOG0195|consensus448 99.84
PHA03100480 ankyrin repeat protein; Provisional 99.84
KOG0514|consensus452 99.84
PHA02946446 ankyin-like protein; Provisional 99.84
PHA02859209 ankyrin repeat protein; Provisional 99.84
PHA02876682 ankyrin repeat protein; Provisional 99.83
KOG0508|consensus 615 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.82
PLN03192823 Voltage-dependent potassium channel; Provisional 99.82
PHA02798489 ankyrin-like protein; Provisional 99.82
PHA02876682 ankyrin repeat protein; Provisional 99.82
PHA02917 661 ankyrin-like protein; Provisional 99.82
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.82
PHA02884300 ankyrin repeat protein; Provisional 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.81
PHA02730 672 ankyrin-like protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
PLN03192823 Voltage-dependent potassium channel; Provisional 99.8
PHA02989494 ankyrin repeat protein; Provisional 99.79
KOG4177|consensus 1143 99.78
PHA02795437 ankyrin-like protein; Provisional 99.78
KOG0510|consensus 929 99.77
KOG0508|consensus 615 99.77
PHA02730672 ankyrin-like protein; Provisional 99.76
PHA02795437 ankyrin-like protein; Provisional 99.76
KOG0514|consensus452 99.75
KOG0512|consensus228 99.73
KOG0507|consensus 854 99.73
KOG4177|consensus 1143 99.72
KOG0502|consensus296 99.71
PHA02917 661 ankyrin-like protein; Provisional 99.71
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
KOG4214|consensus117 99.7
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.69
KOG0505|consensus527 99.69
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.68
KOG1710|consensus396 99.68
KOG4214|consensus117 99.66
KOG0507|consensus 854 99.65
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.64
KOG0195|consensus448 99.64
PHA02792631 ankyrin-like protein; Provisional 99.63
KOG0505|consensus527 99.62
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.62
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.62
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.61
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.59
KOG3676|consensus 782 99.59
PHA02792631 ankyrin-like protein; Provisional 99.58
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.57
KOG0515|consensus752 99.54
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.52
KOG0515|consensus752 99.51
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.5
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.49
KOG3676|consensus 782 99.42
KOG4369|consensus 2131 99.42
KOG0818|consensus 669 99.39
KOG1710|consensus396 99.38
KOG0783|consensus 1267 99.37
KOG4369|consensus 2131 99.31
PF1360630 Ank_3: Ankyrin repeat 99.21
KOG0506|consensus622 99.19
PF1360630 Ank_3: Ankyrin repeat 99.15
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.12
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.12
KOG0522|consensus 560 99.09
KOG2384|consensus223 98.99
KOG0705|consensus749 98.99
PF0053378 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP 98.95
KOG0782|consensus1004 98.87
KOG0521|consensus785 98.86
smart0029280 BRCT breast cancer carboxy-terminal domain. 98.82
KOG0522|consensus 560 98.78
KOG0705|consensus749 98.76
KOG0506|consensus622 98.72
KOG0818|consensus 669 98.72
KOG0783|consensus 1267 98.69
KOG2384|consensus223 98.67
KOG0511|consensus 516 98.66
KOG3609|consensus 822 98.52
cd0002772 BRCT Breast Cancer Suppressor Protein (BRCA1), car 98.49
KOG2043|consensus896 98.46
KOG0782|consensus1004 98.39
KOG0520|consensus975 98.2
KOG3609|consensus 822 98.01
KOG0511|consensus 516 97.94
KOG0520|consensus975 97.91
KOG0521|consensus785 97.9
KOG2505|consensus591 97.85
KOG2481|consensus 570 97.82
KOG3548|consensus1176 97.71
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.69
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.65
KOG1929|consensus 811 97.49
PLN03122 815 Poly [ADP-ribose] polymerase; Provisional 97.37
COG5163 591 NOP7 Protein required for biogenesis of the 60S ri 97.3
KOG2505|consensus591 97.0
KOG4362|consensus 684 96.69
PF1273863 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W 96.62
KOG0966|consensus 881 96.5
PF0053378 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP 95.99
KOG3226|consensus 508 95.75
cd0002772 BRCT Breast Cancer Suppressor Protein (BRCA1), car 95.59
smart0029280 BRCT breast cancer carboxy-terminal domain. 95.08
PLN03123 981 poly [ADP-ribose] polymerase; Provisional 95.08
KOG3548|consensus 1176 95.0
PRK14350669 ligA NAD-dependent DNA ligase LigA; Provisional 94.3
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.12
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.96
KOG3524|consensus 850 92.94
PRK07956665 ligA NAD-dependent DNA ligase LigA; Validated 92.66
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 92.56
KOG0966|consensus881 92.52
PRK14351689 ligA NAD-dependent DNA ligase LigA; Provisional 91.14
PF1273863 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W 88.8
TIGR00575652 dnlj DNA ligase, NAD-dependent. The member of this 88.79
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.73
PRK06063313 DNA polymerase III subunit epsilon; Provisional 88.58
COG0272667 Lig NAD-dependent DNA ligase (contains BRCT domain 87.57
PRK06195309 DNA polymerase III subunit epsilon; Validated 86.93
>KOG4412|consensus Back     alignment and domain information 
Probab=99.96  E-value=1.1e-29  Score=194.09  Aligned_cols=162  Identities=25%  Similarity=0.300  Sum_probs=139.0

Q ss_pred             CCCCCC-CCChHHHHHHHcCCHHHHHHHHH-CCCCCCCCCCCCChHHHHHHHcCCHHHHHHHHhc-CCCCCCCCCCCCCH
Q psy3910           3 PNVKDN-AGWTPLHDAVSIGNESVVRLLLE-AGALVNVPGLDNDTPLHLAARDVRPALAKLLIQY-GADVDKRNIQGHKP   79 (348)
Q Consensus         3 in~~d~-~G~T~Lh~A~~~g~~~~v~~Ll~-~ga~~n~~~~~g~TpLh~A~~~g~~~~v~~Ll~~-gad~~~~d~~g~tp   79 (348)
                      +|.+|. +|+|||||||..|+.++|.+|++ .+..+|.+|..|+||||.|+..|+.++|+.|+.+ |+|+|..+..|.||
T Consensus        30 L~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~  109 (226)
T KOG4412|consen   30 LNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTC  109 (226)
T ss_pred             hhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcce
Confidence            466766 99999999999999999999995 4888999999999999999999999999999988 99999999999999


Q ss_pred             HHHHHHcCCHHHHHHHHHcCC---------CCCCCCCCCCCCchhHHHHH-hcCCCCcccccCCchHHHHHHcCCCCccc
Q psy3910          80 LEYLDVISRDDIKTDILTALS---------LPRLSAAPPPSLPNCIDIVI-YADQLDKTQTSGLAQFVKTLSSGADVPII  149 (348)
Q Consensus        80 L~~A~~~~~~~~~~~Ll~~~~---------~~~~~~~~~~~~~~~~~lli-~~~~~~~~~~~~~~~~~~~la~~~~~~~i  149 (348)
                      ||||+..|+.+|+++|++.|+         .++++.++..+.-....+++ .++.++..++.+.++++.++  -.++.++
T Consensus       110 LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G~TpL~~al--~e~~~d~  187 (226)
T KOG4412|consen  110 LHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPLHHAL--AEGHPDV  187 (226)
T ss_pred             ehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCCcccccCccHHHHHH--hccCchH
Confidence            999999999999999998883         44666665555555555554 58889999999999999998  4456788


Q ss_pred             eeeccccccceeecCCC
Q psy3910         150 VSTLLQSNVNILLVNGT  166 (348)
Q Consensus       150 v~~l~~~g~~~~iv~~~  166 (348)
                      ..+|.+.|++..+.++.
T Consensus       188 a~lLV~~gAd~~~edke  204 (226)
T KOG4412|consen  188 AVLLVRAGADTDREDKE  204 (226)
T ss_pred             HHHHHHhccceeecccc
Confidence            88999999999988864

>KOG4412|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>smart00292 BRCT breast cancer carboxy-terminal domain Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain Back     alignment and domain information
>KOG2043|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2481|consensus Back     alignment and domain information
>KOG3548|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG1929|consensus Back     alignment and domain information
>PLN03122 Poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A Back     alignment and domain information
>KOG0966|consensus Back     alignment and domain information
>PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 Back     alignment and domain information
>KOG3226|consensus Back     alignment and domain information
>cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain Back     alignment and domain information
>smart00292 BRCT breast cancer carboxy-terminal domain Back     alignment and domain information
>PLN03123 poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>KOG3548|consensus Back     alignment and domain information
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG3524|consensus Back     alignment and domain information
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0966|consensus Back     alignment and domain information
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A Back     alignment and domain information
>TIGR00575 dnlj DNA ligase, NAD-dependent Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-12
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-11
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-11
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-11
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-11
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-11
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-11
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-11
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-11
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-11
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-11
3fa2_A218 Crystal Structure Of The Brca1 Associated Ring Doma 3e-10
2r1z_A209 Crystal Structure Of The Bard1 Brct Repeat Length = 4e-10
2nte_A210 Crystal Structure Of The Bard1 Brct Domains Length 4e-10
1uoh_A226 Human Gankyrin Length = 226 5e-10
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-10
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-10
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-09
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-09
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-09
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-09
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-09
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-09
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-08
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-08
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-08
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-08
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-08
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 8e-08
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 9e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-08
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-07
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-07
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-07
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-07
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 5e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 8e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-07
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-06
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-06
1l0b_A229 Crystal Structure Of Rat Brca1 Tandem-Brct Region L 2e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-06
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 3e-06
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-06
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-06
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 4e-06
1ycs_B239 P53-53bp2 Complex Length = 239 4e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 6e-06
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 9e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-05
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-05
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 1e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 3e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 3e-05
3deo_A183 Structural Basis For Specific Substrate Recognition 3e-05
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 4e-05
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 4e-05
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 4e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 6e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 9e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-04
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 3e-04
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 58/83 (69%)
Query: 2   NPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKL 61
           +PNVKD+AGWTPLH+A + G+  VV LLL+  ALVN  G  ND+PLH AA++    + KL
Sbjct: 35  DPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKL 94
Query: 62  LIQYGADVDKRNIQGHKPLEYLD 84
           L+ YGA  +  NI G +P++Y D
Sbjct: 95  LLSYGASRNAVNIFGLRPVDYTD 117
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3FA2|A Chain A, Crystal Structure Of The Brca1 Associated Ring Domain (Bard1) Tandem Brct Domains Length = 218 Back     alignment and structure
>pdb|2R1Z|A Chain A, Crystal Structure Of The Bard1 Brct Repeat Length = 209 Back     alignment and structure
>pdb|2NTE|A Chain A, Crystal Structure Of The Bard1 Brct Domains Length = 210 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1L0B|A Chain A, Crystal Structure Of Rat Brca1 Tandem-Brct Region Length = 229 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-28
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-18
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 4e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-22
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-23
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-21
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-18
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-22
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-22
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-21
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-19
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-22
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-21
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-21
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-21
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-17
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-19
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-14
2rfa_A232 Transient receptor potential cation channel subfa 6e-18
2rfa_A232 Transient receptor potential cation channel subfa 8e-18
2rfa_A232 Transient receptor potential cation channel subfa 8e-18
2rfa_A232 Transient receptor potential cation channel subfa 2e-14
2rfa_A232 Transient receptor potential cation channel subfa 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-09
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 4e-17
1t15_A214 Breast cancer type 1 susceptibility protein; prote 8e-17
2etb_A256 Transient receptor potential cation channel subfam 1e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-15
2etb_A256 Transient receptor potential cation channel subfam 4e-13
2etb_A256 Transient receptor potential cation channel subfam 3e-11
2etb_A256 Transient receptor potential cation channel subfam 8e-07
2etb_A256 Transient receptor potential cation channel subfam 4e-05
2pnn_A273 Transient receptor potential cation channel subfa 3e-15
2pnn_A273 Transient receptor potential cation channel subfa 6e-15
2pnn_A273 Transient receptor potential cation channel subfa 2e-13
2pnn_A273 Transient receptor potential cation channel subfa 1e-10
2pnn_A273 Transient receptor potential cation channel subfa 2e-10
2pnn_A273 Transient receptor potential cation channel subfa 1e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-05
3l41_A220 BRCT-containing protein 1; BRC1, BRCT domain, tand 2e-11
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 4e-11
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-07
3al2_A235 DNA topoisomerase 2-binding protein 1; BRCT domain 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
 Score =  105 bits (266), Expect = 3e-28
 Identities = 42/81 (51%), Positives = 57/81 (70%)

Query: 2   NPNVKDNAGWTPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKL 61
           +PNVKD+AGWTPLH+A + G+  VV LLL+  ALVN  G  ND+PLH AA++    + KL
Sbjct: 35  DPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKL 94

Query: 62  LIQYGADVDKRNIQGHKPLEY 82
           L+ YGA  +  NI G +P++Y
Sbjct: 95  LLSYGASRNAVNIFGLRPVDY 115
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Length = 220 Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Length = 235 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query348
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.91
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.91
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.91
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
1t15_A214 Breast cancer type 1 susceptibility protein; prote 99.91
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.91
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.91
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.91
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.91
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.91
3hra_A201 Ankyrin repeat family protein; structural protein; 99.91
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.91
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.91
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 99.91
2rfa_A232 Transient receptor potential cation channel subfa 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.91
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.91
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.9
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.9
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.9
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.9
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.9
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.9
2etb_A256 Transient receptor potential cation channel subfam 99.9
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.89
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.89
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.89
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.89
2etb_A256 Transient receptor potential cation channel subfam 99.89
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.89
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.89
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.89
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.89
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
2pnn_A273 Transient receptor potential cation channel subfa 99.88
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.88
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.88
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.88
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.88
2rfa_A232 Transient receptor potential cation channel subfa 99.88
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.88
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.88
3hra_A201 Ankyrin repeat family protein; structural protein; 99.87
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.87
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.87
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.87
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.87
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.87
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
2pnn_A273 Transient receptor potential cation channel subfa 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.84
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 99.84
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.83
3al2_A235 DNA topoisomerase 2-binding protein 1; BRCT domain 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.79
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.79
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
2etx_A209 Mediator of DNA damage checkpoint protein 1; tande 99.79
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.72
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.71
3l41_A220 BRCT-containing protein 1; BRC1, BRCT domain, tand 99.7
1kzy_C259 Tumor suppressor P53-binding protein 1; tandem-BRC 99.68
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.58
3olc_X298 DNA topoisomerase 2-binding protein 1; BRCT domain 99.51
2vxb_A241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 99.34
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 99.21
3l46_A112 Protein ECT2; alternative splicing, guanine-nucleo 99.17
4id3_A92 DNA repair protein REV1; BRCT domain, protein bind 99.13
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 99.1
1z56_C264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 98.98
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 98.96
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 98.95
3ii6_X263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 98.93
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 98.9
3pc7_A88 DNA ligase 3; DNA repair, BRCT domain, protein:pro 98.84
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 98.81
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 98.79
3ii6_X 263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 98.64
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 98.63
3olc_X 298 DNA topoisomerase 2-binding protein 1; BRCT domain 98.4
1z56_C 264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 98.4
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 98.35
1kzy_C 259 Tumor suppressor P53-binding protein 1; tandem-BRC 98.31
3ef1_A442 RNA polymerase II subunit A C-terminal domain phos 98.27
2vxb_A 241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 98.23
2jw5_A106 DNA polymerase lambda; BRCT domain, family X polym 98.16
2l42_A106 DNA-binding protein RAP1; BRCT domain, protein bin 98.12
1l7b_A92 DNA ligase; BRCT, autostructure, structural genomi 97.95
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 97.95
3t7k_A256 RTT107, regulator of TY1 transposition protein 107 97.95
2cok_A113 Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r 97.91
2k6g_A109 Replication factor C subunit 1; protein, BRCT, DNA 97.89
2coe_A120 Deoxynucleotidyltransferase, terminal variant; BRC 97.79
2ebu_A112 Replication factor C subunit 1; A/B/A 3 layers, pa 97.71
1l0b_A 229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 97.64
3sqd_A 219 PAX-interacting protein 1; tandem BRCT domains, ce 97.62
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 97.56
1t15_A 214 Breast cancer type 1 susceptibility protein; prote 97.5
2coe_A120 Deoxynucleotidyltransferase, terminal variant; BRC 97.49
2nte_A 210 BARD-1, BRCA1-associated ring domain protein 1; BR 97.47
3al2_A 235 DNA topoisomerase 2-binding protein 1; BRCT domain 97.45
2etx_A 209 Mediator of DNA damage checkpoint protein 1; tande 97.42
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 97.31
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 97.3
2jw5_A106 DNA polymerase lambda; BRCT domain, family X polym 97.28
2dun_A133 POL MU, DNA polymerase MU; layers A/B/A, parallel 97.17
4id3_A92 DNA repair protein REV1; BRCT domain, protein bind 97.13
3l46_A112 Protein ECT2; alternative splicing, guanine-nucleo 97.09
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 97.06
2dun_A133 POL MU, DNA polymerase MU; layers A/B/A, parallel 97.06
3u3z_A 199 Microcephalin; DNA repair, cell cycle regulation, 96.94
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 96.86
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 96.71
3l41_A 220 BRCT-containing protein 1; BRC1, BRCT domain, tand 96.39
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 96.1
3ef1_A442 RNA polymerase II subunit A C-terminal domain phos 95.85
1dgs_A667 DNA ligase; AMP complex, NAD+-dependent; HET: DNA 94.81
3pc7_A88 DNA ligase 3; DNA repair, BRCT domain, protein:pro 93.76
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 93.09
2owo_A671 DNA ligase; protein-DNA complex, ligase-DNA comple 92.0
3huf_A325 DNA repair and telomere maintenance protein NBS1; 91.13
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
Probab=100.00  E-value=1.1e-33  Score=235.46  Aligned_cols=203  Identities=26%  Similarity=0.421  Sum_probs=170.1

Q ss_pred             HhcCCCCcccccCCchHHHHHHcCCCCccceeeccccccceeecCCCCCchHhhHHHHHHHHhccceeecHHHHHHHHhc
Q psy3910         120 IYADQLDKTQTSGLAQFVKTLSSGADVPIIVSTLLQSNVNILLVNGTPERTCIATCNVLRAILSGIKAVDYTWISRSLEI  199 (348)
Q Consensus       120 i~~~~~~~~~~~~~~~~~~~la~~~~~~~iv~~l~~~g~~~~iv~~~~~~~~~~tl~~l~~i~~g~~iv~~~wi~~~~~~  199 (348)
                      +..+++....+..+..+...+  |+   .++..+.+. +||+++..+.   ..++.|++.++..|+|||+.+|+.+|++.
T Consensus         5 i~~sg~~~~~~~~l~~~~~~~--G~---~~~~~~~~~-~THlV~~~~~---~~rt~K~l~a~~~g~~IV~~~Wl~~c~~~   75 (210)
T 2nte_A            5 LIGSGLSSEQQKMLSELAVIL--KA---KKYTEFDST-VTHVVVPGDA---VQSTLKCMLGILNGCWILKFEWVKACLRR   75 (210)
T ss_dssp             EEESSCCHHHHHHHHHHHHHT--TC---EEESSCCTT-CCEEEESSSS---CCCSHHHHHHHHTTCEEEETHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHHHHHc--CC---EEeCCCCCC-CeEEEEcCCC---cchHHHHHHHHhcCCEEecHHHHHHHHHc
Confidence            344556666666666666666  77   677776666 9999998543   45789999999999999999999999999


Q ss_pred             CCCccCccceecccccCCCCchhhhhHHhHhhhCCCCCcceEEEecCCCCCCCCCChHHHHHHHHHcCceeeccCCCCCc
Q psy3910         200 GKVLPVEEFEILGTVDYPLAKPFHRSRENKENLLPGLFNGLQVYLTKPWPTSSPLSSEDMRDIFKRGGATLLNREPDPES  279 (348)
Q Consensus       200 ~~~~~e~~~ei~~~~~~~~~~~~~~~r~~~~~~~p~lf~g~~~~~~~~~~~~~~~~~~~l~~li~~~Gg~v~~~~p~~~~  279 (348)
                      +++++|++|++.+.     |   +++|.++.+..++||.|+.||+.+.|.   .++++.|++||+++||+|+.+.|.+++
T Consensus        76 ~~~~~e~~y~~~~~-----~---~~~r~~~~~~~~~lF~g~~~~l~~~~~---~~~~~~l~~lI~~~GG~v~~~~p~~~~  144 (210)
T 2nte_A           76 KVCEQEEKYEIPEG-----P---RRSRLNREQLLPKLFDGCYFYLWGTFK---HHPKDNLIKLVTAGGGQILSRKPKPDS  144 (210)
T ss_dssp             TSCCCGGGTBCTTH-----H---HHHHHHHHTTCCCTTTTCEEEECSCCS---SSCHHHHHHHHHHTTCEEESSCCCGGG
T ss_pred             CCcCChhhccCCCC-----C---hhhhhccccccccccCceEEEEeccCC---CCCHHHHHHHHHHCCCEEEecCCCCcc
Confidence            99999999999864     5   888888888889999999999999776   789999999999999999999999876


Q ss_pred             -ccccccceeecc-CCCCccccCCceEEEeccC-CCcccccccccccccchHHHHHHHhhccccCCCC
Q psy3910         280 -MNLSESSVMYHV-NRPQHRLYNLSQAIVYSEE-ALPRRLYNMEHVKALGLSWVRACVEQFEIVQPKS  344 (348)
Q Consensus       280 -~~~~~~~~~~~~-~~~~~~~~~~~~~i~~~~~-~~~~~~~~~~~~~~~~~~W~~dci~~~~l~~~~~  344 (348)
                       .++..+.++||+ .+.++.  .||++|||.+. +..+...++.++.+|+.+||+|||++|+|||.+|
T Consensus       145 ~~~~~~~~v~~~~~~~~~~~--~~t~~iv~~~~~~~~~~~~~~~~v~~V~~~Wl~dcI~~~~llp~~~  210 (210)
T 2nte_A          145 DVTQTINTVAYHARPDSDQR--FCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS  210 (210)
T ss_dssp             CGGGSSCCCCTTSCTTCGGG--TCCEEEEECSCSSCCCSCSEETTEEEEEHHHHHHHHHHTSCCCSCC
T ss_pred             ccccccceeeeccCCCcccc--cceEEEEeccccccCHHHHhccCcccccHHHHHHHHHhCeeccCCC
Confidence             777777899999 455443  49999999987 4444455667889999999999999999999986
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Back     alignment and structure
>4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Back     alignment and structure
>3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 Back     alignment and structure
>3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A Back     alignment and structure
>2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A Back     alignment and structure
>2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A Back     alignment and structure
>2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* Back     alignment and structure
>4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* Back     alignment and structure
>3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* Back     alignment and structure
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 348
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-18
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-18
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-16
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-11
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-05
d1t15a1109 c.15.1.3 (A:1649-1757) Breast cancer associated pr 1e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-05
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: RNase L, 2-5a-dependent ribonuclease
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 82.7 bits (203), Expect = 1e-18
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 2   NPNVKDNAGWTPLHDAVSIGNESVVRLLLE-AGALVNVPGLDNDTPLHLAARDVRPALAK 60
           + NV+   G TPL  AV   +  +V+ LLE     +N    D  T L LA       +A+
Sbjct: 211 DVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAE 270

Query: 61  LLIQYGADVDKRNI 74
           LL + GA  D  ++
Sbjct: 271 LLCKRGASTDCGDL 284
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query348
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.88
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.87
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.86
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.85
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.85
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.84
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.83
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.83
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.83
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.83
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.82
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.82
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.79
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.79
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.77
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.77
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.75
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.75
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.75
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.75
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.73
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1l0ba297 Breast cancer associated protein, BRCA1 {Rat (Ratt 99.66
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.65
d1t15a2102 Breast cancer associated protein, BRCA1 {Human (Ho 99.56
d1cdza_96 DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta 99.38
d1t15a1109 Breast cancer associated protein, BRCA1 {Human (Ho 99.35
d1wf6a_132 DNA topoisomerase II binding protein 1, TopBP1 {Hu 99.15
d1in1a_88 DNA ligase III alpha {Human (Homo sapiens) [TaxId: 99.09
d1t15a1109 Breast cancer associated protein, BRCA1 {Human (Ho 98.11
d1wf6a_132 DNA topoisomerase II binding protein 1, TopBP1 {Hu 97.9
d1kzyc1153 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1l7ba_92 NAD+-dependent DNA ligase, domain 4 {Thermus therm 97.83
d1kzyc2106 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1kzyc1153 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1cdza_96 DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta 97.62
d1in1a_88 DNA ligase III alpha {Human (Homo sapiens) [TaxId: 95.26
d1t15a2102 Breast cancer associated protein, BRCA1 {Human (Ho 93.31
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.91  E-value=6.4e-25  Score=166.70  Aligned_cols=91  Identities=19%  Similarity=0.228  Sum_probs=88.0

Q ss_pred             hHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCChHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHH
Q psy3910          12 TPLHDAVSIGNESVVRLLLEAGALVNVPGLDNDTPLHLAARDVRPALAKLLIQYGADVDKRNIQGHKPLEYLDVISRDDI   91 (348)
Q Consensus        12 T~Lh~A~~~g~~~~v~~Ll~~ga~~n~~~~~g~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~g~tpL~~A~~~~~~~~   91 (348)
                      ++||.||..|+.++|+.|+++|+|+|.+|.+|+||||+|+..|+.+++++|+++|+|++.+|.+|+||||+|+..|+.++
T Consensus         3 ~lL~~A~~~G~~~~v~~Ll~~g~d~n~~d~~g~t~Lh~A~~~~~~~~~~~ll~~g~~~~~~d~~g~tpLh~A~~~g~~~~   82 (130)
T d1ycsb1           3 ALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQV   82 (130)
T ss_dssp             HHHHHHHHHTCHHHHHHHTSTTSSCCCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHTTCHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHcCCCccccccccccccccccccccccccccccccccccccccccCcccccccchhhHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCC
Q psy3910          92 KTDILTALSLP  102 (348)
Q Consensus        92 ~~~Ll~~~~~~  102 (348)
                      +++|+++|++.
T Consensus        83 v~~Ll~~ga~v   93 (130)
T d1ycsb1          83 CKFLVESGAAV   93 (130)
T ss_dssp             HHHHHHTTCCT
T ss_pred             HHHHHHcCCCc
Confidence            99999998554
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure