Diaphorina citri psyllid: psy3924


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKADAATLQAN
cccccccccccccccccccccHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccc
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTY**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKADAATLQAN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone-lysine N-methyltransferase MLL3 Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/MLL3 complex, a coactivator complex of nuclear receptors, involved in transcriptional coactivation. MLL3 may be a catalytic subunit of this complex.confidentQ8BRH4
Histone-lysine N-methyltransferase MLL3 Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/MLL3 complex, a coactivator complex of nuclear receptors, involved in transcriptional coactivation. MLL3 may be a catalytic subunit of this complex. May be involved in leukemogenesis and developmental disorder.confidentQ8NEZ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051568 [BP]histone H3-K4 methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0034968, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0044666 [CC]MLL3/4 complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0032453 [MF]histone demethylase activity (H3-K4 specific)probableGO:0032451, GO:0032452, GO:0003674, GO:0003824
GO:0004402 [MF]histone acetyltransferase activityprobableGO:0008080, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043627 [BP]response to estrogen stimulusprobableGO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0016573 [BP]histone acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0030374 [MF]ligand-dependent nuclear receptor transcription coactivator activityprobableGO:0003674, GO:0003713, GO:0003712, GO:0000989, GO:0000988
GO:0042800 [MF]histone methyltransferase activity (H3-K4 specific)probableGO:0018024, GO:0042054, GO:0003824, GO:0008757, GO:0016740, GO:0016278, GO:0016279, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0090544 [CC]BAF-type complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0070603, GO:0043227, GO:0043226, GO:0044422
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0034720 [BP]histone H3-K4 demethylationprobableGO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016577, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0070076, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YSM, chain A
Confidence level:very confident
Coverage over the Query: 6-91
View the alignment between query and template
View the model in PyMOL
Template: 2YSM, chain A
Confidence level:very confident
Coverage over the Query: 37-118
View the alignment between query and template
View the model in PyMOL