Psyllid ID: psy3924

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKADAATLQAN
ccccccccccccccccccccHHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccc
cccccccccccccccccccccccEEEEcccccccccEEEEEcccccccccEEEEcccccccccccccccccccccccccccccEEcccccccccccccccccccHEEEEHcccccccEEEEEcccEEEEcc
mncdviaygsvcrdvklhdlpISKVilskgwrcldctvcegcaqrhdegrlilcdecdisyhiyctdppldhiprgtwkckwcaqcltcgatgyhiyctdppldhiifvqdkirpkrltTYKADAATLQAN
mncdviaygsvcrdvklhdLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKAdaatlqan
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKADAATLQAN
**CDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTY**********
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHI*************************
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKADAATLQAN
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKADAATLQAN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNCDVIAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTCGATGYHIYCTDPPLDHIIFVQDKIRPKRLTTYKADAATLQAN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q8NEZ4 4911 Histone-lysine N-methyltr yes N/A 0.534 0.014 0.632 5e-30
Q8BRH4 4903 Histone-lysine N-methyltr yes N/A 0.534 0.014 0.632 8e-30
Q6PDK2 5588 Histone-lysine N-methyltr no N/A 0.458 0.010 0.597 6e-28
O14686 5537 Histone-lysine N-methyltr no N/A 0.458 0.010 0.597 6e-28
Q9VWF2 2006 Supporter of activation o no N/A 0.549 0.035 0.368 3e-11
Q8WYB5 2073 Histone acetyltransferase no N/A 0.404 0.025 0.388 1e-10
Q30DN6 1545 Lysine-specific demethyla no N/A 0.404 0.034 0.472 1e-10
Q8WML3 1784 Histone acetyltransferase N/A N/A 0.404 0.029 0.388 1e-10
Q8BRB7 1872 Histone acetyltransferase no N/A 0.404 0.028 0.388 1e-10
A9LMC0391 Zinc finger protein DPF3 no N/A 0.419 0.140 0.333 1e-10
>sp|Q8NEZ4|MLL3_HUMAN Histone-lysine N-methyltransferase MLL3 OS=Homo sapiens GN=MLL3 PE=1 SV=3 Back     alignment and function desciption
 Score =  129 bits (324), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 60/79 (75%)

Query: 20   LPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWK 79
            + I+KV+LSKGWRCL+CTVCE C +  D GRL+LCD+CDISYH YC DPPL  +P+G WK
Sbjct: 991  IKITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWK 1050

Query: 80   CKWCAQCLTCGATGYHIYC 98
            CKWC  C  CGAT   + C
Sbjct: 1051 CKWCVWCRHCGATSAGLRC 1069
Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/MLL3 complex, a coactivator complex of nuclear receptors, involved in transcriptional coactivation. MLL3 may be a catalytic subunit of this complex. May be involved in leukemogenesis and developmental disorder.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3
>sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=Mus musculus GN=Mll3 PE=2 SV=2 Back     alignment and function description
>sp|Q6PDK2|MLL2_MOUSE Histone-lysine N-methyltransferase MLL2 OS=Mus musculus GN=Mll2 PE=1 SV=2 Back     alignment and function description
>sp|O14686|MLL2_HUMAN Histone-lysine N-methyltransferase MLL2 OS=Homo sapiens GN=MLL2 PE=1 SV=2 Back     alignment and function description
>sp|Q9VWF2|SAYP_DROME Supporter of activation of yellow protein OS=Drosophila melanogaster GN=e(y)3 PE=2 SV=3 Back     alignment and function description
>sp|Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens GN=KAT6B PE=1 SV=3 Back     alignment and function description
>sp|Q30DN6|KDM5D_CANFA Lysine-specific demethylase 5D OS=Canis familiaris GN=KDM5D PE=2 SV=1 Back     alignment and function description
>sp|Q8WML3|KAT6B_MACFA Histone acetyltransferase KAT6B OS=Macaca fascicularis GN=KAT6B PE=2 SV=1 Back     alignment and function description
>sp|Q8BRB7|KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus GN=Kat6b PE=2 SV=3 Back     alignment and function description
>sp|A9LMC0|DPF3_DANRE Zinc finger protein DPF3 OS=Danio rerio GN=dpf3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
345490044 5138 PREDICTED: LOW QUALITY PROTEIN: hypothet 0.603 0.015 0.738 4e-36
328717947 2904 PREDICTED: hypothetical protein LOC10015 0.664 0.029 0.706 5e-36
328776663 4678 PREDICTED: hypothetical protein LOC41146 0.603 0.016 0.714 6e-35
405958289 4990 Histone-lysine N-methyltransferase MLL3 0.610 0.016 0.705 9e-35
383848022 4805 PREDICTED: uncharacterized protein LOC10 0.603 0.016 0.714 9e-35
380024451 5713 PREDICTED: uncharacterized protein LOC10 0.603 0.013 0.714 1e-34
270001730 5215 hypothetical protein TcasGA2_TC000606 [T 0.664 0.016 0.673 3e-34
350405219 5619 PREDICTED: hypothetical protein LOC10074 0.603 0.014 0.702 9e-34
340726153 5622 PREDICTED: hypothetical protein LOC10064 0.603 0.014 0.702 9e-34
332023034 3474 Histone-lysine N-methyltransferase trr [ 0.603 0.022 0.726 3e-33
>gi|345490044|ref|XP_001603865.2| PREDICTED: LOW QUALITY PROTEIN: hypothetical protein LOC100120205 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 62/84 (73%), Positives = 71/84 (84%), Gaps = 5/84 (5%)

Query: 8   YGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTD 67
           Y   C +VK     ++KVIL KGWRCLDCTVCEGC +R+DEGRLILCD+CDISYHIYCTD
Sbjct: 500 YHPYCANVK-----VTKVILQKGWRCLDCTVCEGCGERNDEGRLILCDDCDISYHIYCTD 554

Query: 68  PPLDHIPRGTWKCKWCAQCLTCGA 91
           PPL+ +P+GTWKCKWCAQC TCGA
Sbjct: 555 PPLECVPQGTWKCKWCAQCQTCGA 578

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328717947|ref|XP_001943997.2| PREDICTED: hypothetical protein LOC100159693, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328776663|ref|XP_394941.4| PREDICTED: hypothetical protein LOC411466 [Apis mellifera] Back     alignment and taxonomy information
>gi|405958289|gb|EKC24431.1| Histone-lysine N-methyltransferase MLL3 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|383848022|ref|XP_003699651.1| PREDICTED: uncharacterized protein LOC100881339 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380024451|ref|XP_003696009.1| PREDICTED: uncharacterized protein LOC100866111 [Apis florea] Back     alignment and taxonomy information
>gi|270001730|gb|EEZ98177.1| hypothetical protein TcasGA2_TC000606 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350405219|ref|XP_003487363.1| PREDICTED: hypothetical protein LOC100745609 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726153|ref|XP_003401426.1| PREDICTED: hypothetical protein LOC100646364 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332023034|gb|EGI63299.1| Histone-lysine N-methyltransferase trr [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
ZFIN|ZDB-GENE-091118-99 589 si:ch211-244o18.1 "si:ch211-24 0.587 0.130 0.662 2e-29
UNIPROTKB|H7C212228 MLL3 "Histone-lysine N-methylt 0.603 0.346 0.632 5.6e-29
ZFIN|ZDB-GENE-070705-340 4879 mll3b "myeloid/lymphoid or mix 0.610 0.016 0.637 4.2e-28
MGI|MGI:2444959 4903 Mll3 "myeloid/lymphoid or mixe 0.603 0.016 0.632 7.5e-27
UNIPROTKB|Q8NEZ4 4911 MLL3 "Histone-lysine N-methylt 0.603 0.016 0.632 7.5e-27
UNIPROTKB|F1NW66 4880 Gga.49064 "Uncharacterized pro 0.603 0.016 0.632 9.5e-27
UNIPROTKB|F1MYZ3 4824 Bt.18271 "Uncharacterized prot 0.557 0.015 0.671 2.5e-26
UNIPROTKB|J9P5P6 4265 MLL3 "Uncharacterized protein" 0.603 0.018 0.620 3.5e-26
UNIPROTKB|F1P7W6 4837 MLL3 "Uncharacterized protein" 0.603 0.016 0.620 4.1e-26
UNIPROTKB|D4ADM0733 LOC100362634 "Protein LOC10036 0.564 0.100 0.618 1.5e-25
ZFIN|ZDB-GENE-091118-99 si:ch211-244o18.1 "si:ch211-244o18.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 2.0e-29, P = 2.0e-29
 Identities = 51/77 (66%), Positives = 61/77 (79%)

Query:    22 ISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCK 81
             I+KV+LSKGWRCL+CTVCE C Q  D GRL+LCD+CDISYH YC DPPL ++P+G+WKCK
Sbjct:     2 ITKVVLSKGWRCLECTVCEACGQASDPGRLLLCDDCDISYHTYCLDPPLQNVPKGSWKCK 61

Query:    82 WCAQCLTCGATGYHIYC 98
             WC  C  CGAT   + C
Sbjct:    62 WCVLCTHCGATSPGLRC 78
GO:0008270 "zinc ion binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|H7C212 MLL3 "Histone-lysine N-methyltransferase MLL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-340 mll3b "myeloid/lymphoid or mixed-lineage leukemia 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2444959 Mll3 "myeloid/lymphoid or mixed-lineage leukemia 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NEZ4 MLL3 "Histone-lysine N-methyltransferase MLL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NW66 Gga.49064 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYZ3 Bt.18271 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P5P6 MLL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7W6 MLL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4ADM0 LOC100362634 "Protein LOC100362634" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BRH4MLL3_MOUSE2, ., 1, ., 1, ., 4, 30.63290.53430.0142yesN/A
Q8NEZ4MLL3_HUMAN2, ., 1, ., 1, ., 4, 30.63290.53430.0142yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam0062851 pfam00628, PHD, PHD-finger 1e-06
smart0024947 smart00249, PHD, PHD zinc finger 1e-06
COG5141 669 COG5141, COG5141, PHD zinc finger-containing prote 0.002
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 42.5 bits (100), Expect = 1e-06
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 38 VCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDH--IPRGTWKCKWCAQC 86
           C  C +  D+G L+LCD CD  +H+ C  PPL+   IP G W C  C   
Sbjct: 1  YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKPK 51

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
KOG1244|consensus336 99.61
KOG4443|consensus 694 99.53
KOG1512|consensus381 99.42
KOG1244|consensus336 99.02
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.98
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.8
KOG0825|consensus 1134 98.68
KOG0383|consensus 696 98.56
KOG4299|consensus 613 98.53
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.32
KOG4443|consensus 694 98.27
KOG0957|consensus707 97.92
KOG1973|consensus274 97.77
KOG1245|consensus 1404 97.74
KOG0955|consensus 1051 97.57
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 97.57
KOG0954|consensus 893 97.35
COG5141 669 PHD zinc finger-containing protein [General functi 97.34
KOG1512|consensus381 97.31
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.22
KOG4323|consensus 464 97.15
KOG0956|consensus 900 96.99
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 96.95
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 96.12
KOG0825|consensus 1134 95.54
KOG0383|consensus 696 95.3
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 94.96
KOG4299|consensus 613 94.02
KOG1473|consensus 1414 93.94
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 93.84
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 93.38
KOG0956|consensus 900 93.27
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 92.48
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 92.14
KOG0957|consensus 707 91.22
KOG1246|consensus 904 91.11
KOG1473|consensus 1414 87.12
PF13901202 DUF4206: Domain of unknown function (DUF4206) 86.67
KOG0955|consensus 1051 86.32
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.18
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 83.84
PF0064130 zf-RanBP: Zn-finger in Ran binding protein and oth 82.78
COG5141 669 PHD zinc finger-containing protein [General functi 81.28
>KOG1244|consensus Back     alignment and domain information 
Probab=99.61  E-value=8.4e-17  Score=124.21  Aligned_cols=76  Identities=29%  Similarity=0.937  Sum_probs=67.8

Q ss_pred             eeeccccCCCCCCCCCccccccCCCccCccCcccccccccCCCCCceeeCcCCCcccCCCCCCCCCCCCCCCeeccCCC
Q psy3924           6 IAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCA   84 (131)
Q Consensus         6 ~~~H~~Cl~~~~~~~~~~~~~~~~~W~C~~C~~C~~C~~~~~~~~ll~Cd~C~~~~H~~Cl~p~l~~~p~~~W~C~~C~   84 (131)
                      .+-|++||+-...   ++..++.+.|+|.+|+.|.+|+-.++.++||+||.|+++|||+||.||+...|+|.|.|.-|.
T Consensus       254 rsghpsclqft~n---m~~avk~yrwqcieck~csicgtsenddqllfcddcdrgyhmyclsppm~eppegswsc~KOG  329 (336)
T KOG1244|consen  254 RSGHPSCLQFTAN---MIAAVKTYRWQCIECKYCSICGTSENDDQLLFCDDCDRGYHMYCLSPPMVEPPEGSWSCHLCL  329 (336)
T ss_pred             CCCCcchhhhhHH---HHHHHHhheeeeeecceeccccCcCCCceeEeecccCCceeeEecCCCcCCCCCCchhHHHHH
Confidence            4679999986654   344567899999999999999999999999999999999999999999999999999998774

>KOG4443|consensus Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG1973|consensus Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0954|consensus Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG1246|consensus Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2ysm_A111 Solution Structure Of The First And Second Phd Doma 2e-11
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 2e-10
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 6e-09
2ln0_A110 Structure Of Moz Length = 110 3e-08
3v43_A112 Crystal Structure Of Moz Length = 112 3e-08
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 3e-07
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 3e-07
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 5e-07
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 5e-07
2e6s_A77 Solution Structure Of The Phd Domain In Ring Finger 5e-07
3shb_A77 Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 9e-07
3zvz_B57 Phd Finger Of Human Uhrf1 Length = 57 9e-07
3sou_A70 Structure Of Uhrf1 Phd Finger In Complex With Histo 9e-07
3zvy_A72 Phd Finger Of Human Uhrf1 In Complex With Unmodifie 1e-06
3t6r_A72 Structure Of Uhrf1 In Complex With Unmodified H3 N- 1e-06
2lgg_A69 Structure Of Phd Domain Of Uhrf1 In Complex With H3 1e-06
1f62_A51 Wstf-Phd Length = 51 1e-06
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 4e-06
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 2e-05
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 2e-05
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 6e-05
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 2e-04
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 49/86 (56%), Gaps = 6/86 (6%)
Query: 8   YGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTD 67
           Y  +C D+ +   P+ +     GW+C +C VC+ C Q  ++ ++++CD CD  YH +C  
Sbjct: 32  YHGMCLDIAV--TPLKRA----GWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQ 85
Query: 68  PPLDHIPRGTWKCKWCAQCLTCGATG 93
           P +  +P   WKCK C  C++  ++G
Sbjct: 86  PVMKSVPTNGWKCKNCRICISGPSSG 111
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 Back     alignment and structure
>pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 Back     alignment and structure
>pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 Back     alignment and structure
>pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 Back     alignment and structure
>pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 3e-20
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 1e-17
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 5e-08
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-17
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 7e-13
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-17
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 5e-16
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 3e-15
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 8e-15
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 6e-14
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 6e-14
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-13
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 8e-09
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-12
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 6e-12
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 1e-11
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-11
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 8e-11
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 1e-10
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-08
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 5e-08
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-07
2yt5_A66 Metal-response element-binding transcription facto 2e-07
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 3e-07
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 1e-06
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 4e-06
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 5e-04
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
 Score = 78.0 bits (192), Expect = 3e-20
 Identities = 22/65 (33%), Positives = 35/65 (53%)

Query: 28 SKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCL 87
              + +D  +C+ C++  ++ +L+ CD CD +YHI+C  PPL  IPRG W+C  C    
Sbjct: 8  HSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCILAE 67

Query: 88 TCGAT 92
               
Sbjct: 68 CKQPP 72
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.85
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.82
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.8
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.73
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.68
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.68
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.64
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.58
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.55
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.53
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.48
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.47
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.46
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.42
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.4
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.36
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.34
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.34
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.33
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.3
2yt5_A66 Metal-response element-binding transcription facto 99.25
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.18
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.18
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.16
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.13
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.12
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.08
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.08
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.07
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.9
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.72
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.63
1weu_A91 Inhibitor of growth family, member 4; structural g 98.62
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.57
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.51
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.51
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.46
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.32
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.19
1we9_A64 PHD finger family protein; structural genomics, PH 98.12
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 98.1
1wee_A72 PHD finger family protein; structural genomics, PH 98.08
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.0
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.99
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.92
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 97.78
1wem_A76 Death associated transcription factor 1; structura 97.77
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.76
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.75
1wew_A78 DNA-binding family protein; structural genomics, P 97.74
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.73
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 97.7
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 97.7
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.67
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 97.61
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 97.57
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.57
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 97.56
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 97.55
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.54
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 97.53
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 97.52
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 97.49
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.49
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 97.48
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 97.38
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 96.8
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 96.75
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.74
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 96.73
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 96.72
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 96.47
2k16_A75 Transcription initiation factor TFIID subunit 3; p 96.46
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 96.41
2yt5_A66 Metal-response element-binding transcription facto 96.38
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 96.25
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 96.09
1weu_A91 Inhibitor of growth family, member 4; structural g 96.03
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 96.0
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 95.98
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 95.62
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 95.49
3kv5_D 488 JMJC domain-containing histone demethylation prote 95.32
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 95.08
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 94.93
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 94.91
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 94.8
1x4i_A70 Inhibitor of growth protein 3; structural genomics 94.56
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 93.3
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 91.93
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 91.19
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 90.45
1we9_A64 PHD finger family protein; structural genomics, PH 89.78
3o70_A68 PHD finger protein 13; PHF13, structural genomics 89.52
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 88.98
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 88.5
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 88.2
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 88.09
1wee_A72 PHD finger family protein; structural genomics, PH 87.33
1wew_A78 DNA-binding family protein; structural genomics, P 86.05
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 83.76
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 83.22
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 82.99
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 81.83
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
Probab=99.85  E-value=7.1e-22  Score=134.43  Aligned_cols=80  Identities=34%  Similarity=1.019  Sum_probs=71.6

Q ss_pred             eeeccccCCCCCCCCCccccccCCCccCccCcccccccccCCCCCceeeCcCCCcccCCCCCCCCCCCCCCCeeccCCCc
Q psy3924           6 IAYGSVCRDVKLHDLPISKVILSKGWRCLDCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQ   85 (131)
Q Consensus         6 ~~~H~~Cl~~~~~~~~~~~~~~~~~W~C~~C~~C~~C~~~~~~~~ll~Cd~C~~~~H~~Cl~p~l~~~p~~~W~C~~C~~   85 (131)
                      .+||++||++++..+      .+..|+|++|++|.+|++.++.+.||+|+.|+++||++|++|++..+|.++|+|+.|..
T Consensus        30 ~~~H~~Cl~~~~~~~------~~~~W~C~~C~~C~~C~~~~~~~~ll~Cd~C~~~yH~~Cl~ppl~~~P~g~W~C~~C~~  103 (111)
T 2ysm_A           30 QHYHGMCLDIAVTPL------KRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRI  103 (111)
T ss_dssp             CEECTTTTTCCCCTT------TSTTCCCTTTCCCTTTCCCSCCTTEEECSSSCCEEEGGGSSSCCSSCCSSCCCCHHHHC
T ss_pred             CCcChHHhCCccccc------cccCccCCcCCcccccCccCCCCCeeECCCCCcHHhHHhcCCccccCCCCCcCCcCCcC
Confidence            789999999885432      45699999999999999988888999999999999999999999999999999999988


Q ss_pred             cccCCC
Q psy3924          86 CLTCGA   91 (131)
Q Consensus        86 c~~Cg~   91 (131)
                      |..+++
T Consensus       104 c~~g~s  109 (111)
T 2ysm_A          104 CISGPS  109 (111)
T ss_dssp             CSCSCC
T ss_pred             cCCCCC
Confidence            877654
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 6e-11
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 2e-10
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 3e-08
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-07
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-07
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 1e-05
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-04
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Nuclear corepressor KAP-1 (TIF-1beta)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 52.3 bits (125), Expect = 6e-11
 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%)

Query: 35 DCTVCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQCLTC 89
            T+C  C      G L++C++C+  +H+ C  P L  +P   W C  C      
Sbjct: 6  SATICRVC---QKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDL 57
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.47
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.44
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.2
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.83
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.55
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.5
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.44
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.44
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.15
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.13
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.64
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 97.53
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 97.49
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 96.8
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 96.79
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 96.24
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 95.17
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 94.79
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 93.89
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 92.15
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 91.47
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 88.13
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 82.24
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.47  E-value=7.6e-15  Score=85.27  Aligned_cols=49  Identities=37%  Similarity=1.112  Sum_probs=44.5

Q ss_pred             ccccccccCCCCCceeeCcCCCcccCCCCCCCCCCCCCCCeeccCCCcc
Q psy3924          38 VCEGCAQRHDEGRLILCDECDISYHIYCTDPPLDHIPRGTWKCKWCAQC   86 (131)
Q Consensus        38 ~C~~C~~~~~~~~ll~Cd~C~~~~H~~Cl~p~l~~~p~~~W~C~~C~~c   86 (131)
                      .|.+|++.++++.||+|+.|++.||++|++|++..+|+++|+|+.|+.+
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~~   50 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPA   50 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSCC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcCc
Confidence            4677788888899999999999999999999999999999999999864
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure