Diaphorina citri psyllid: psy3948


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV
ccccccccccccccHHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccHHHccccccccccccccccHHccccHHHHHHHHHccccccccccHHHHHHcccHHHHHHHHccccccccccccccHHHHccc
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0010558 [BP]negative regulation of macromolecule biosynthetic processprobableGO:0009892, GO:0019222, GO:0009890, GO:0060255, GO:0009889, GO:0008150, GO:0010556, GO:0065007, GO:0048519, GO:0010605, GO:0050789
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051253 [BP]negative regulation of RNA metabolic processprobableGO:0051252, GO:0010605, GO:0045934, GO:0019222, GO:0060255, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0009892, GO:0050789, GO:0048523, GO:0080090
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0031327 [BP]negative regulation of cellular biosynthetic processprobableGO:0009889, GO:0019222, GO:0009890, GO:0031326, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0009892, GO:0050789, GO:0048523
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 17-135
View the alignment between query and template
View the model in PyMOL