Psyllid ID: psy3948


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV
ccccccccccccccHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccHHHcccccccccccccccHHHHcccHHHHHHHHHccccccccccHHHHHHcccHHHHHHHHHcccccccccccccHHHHccc
ccccccEEEccHccHHHcccccHHHHHHHcccccccccccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccHHHHHHHccHHHHHHHccccccEEEEHHHHHHHHHcc
mfvdhtilKCTFCNIIFNKLQDEELIMTHCksckkpkrpdksynyacfictyhtrkhgdmighmrkhtgvkplkcsscnyscstksaLSVHQKrhtglkahkCANVIIIAIMYHILEIMLEdiqgrdhiNVNIALTLQFSALV
mfvdhtilkCTFCNIIFNKLQDEELIMTHCKsckkpkrpdksyNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRhtglkahkcANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV
**VDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKP**PDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFS***
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQF****
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSC***************LKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV
*FVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKP*RPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIALTLQFSALV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
O13089 522 DNA-binding protein Ikaro N/A N/A 0.615 0.168 0.350 7e-10
Q1LZ87 534 Zinc finger protein 397 O yes N/A 0.384 0.102 0.397 2e-09
Q8VIG1 1082 RE1-silencing transcripti yes N/A 0.405 0.053 0.371 2e-09
Q2EI20 855 RE1-silencing transcripti yes N/A 0.713 0.119 0.297 2e-09
Q13127 1097 RE1-silencing transcripti no N/A 0.482 0.062 0.371 3e-09
Q8NF99 534 Zinc finger protein 397 O yes N/A 0.384 0.102 0.382 3e-09
Q5R4K8730 Zinc finger protein 615 O no N/A 0.433 0.084 0.435 4e-09
O54963 1069 RE1-silencing transcripti no N/A 0.482 0.064 0.371 4e-09
Q8N8J6731 Zinc finger protein 615 O no N/A 0.433 0.084 0.435 4e-09
Q13422 519 DNA-binding protein Ikaro no N/A 0.615 0.169 0.340 5e-09
>sp|O13089|IKZF1_ONCMY DNA-binding protein Ikaros OS=Oncorhynchus mykiss GN=ikzf1 PE=2 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 9/97 (9%)

Query: 8   LKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKH 67
           LKC  C I+        ++M H +S    +RP     + C  C     + G+++ H++ H
Sbjct: 125 LKCDICGIV---CIGPNVLMVHKRS-HTGERP-----FQCTQCGASFTQKGNLLRHIKLH 175

Query: 68  TGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCA 104
           +G KP KC  CNY+C  + ALS H + H+  K HKCA
Sbjct: 176 SGEKPFKCHLCNYACRRRDALSGHLRTHSVGKPHKCA 212




Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Functions in the specification and the maturation of the T-lymphocyte. Also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.
Oncorhynchus mykiss (taxid: 8022)
>sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 Back     alignment and function description
>sp|Q8VIG1|REST_MOUSE RE1-silencing transcription factor OS=Mus musculus GN=Rest PE=2 SV=2 Back     alignment and function description
>sp|Q2EI20|REST_DANRE RE1-silencing transcription factor OS=Danio rerio GN=rest PE=2 SV=1 Back     alignment and function description
>sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 Back     alignment and function description
>sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 Back     alignment and function description
>sp|O54963|REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus GN=Rest PE=2 SV=1 Back     alignment and function description
>sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 Back     alignment and function description
>sp|Q13422|IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens GN=IKZF1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
348511898 973 PREDICTED: RE1-silencing transcription f 0.713 0.104 0.306 2e-09
432961017 871 PREDICTED: RE1-silencing transcription f 0.713 0.117 0.306 4e-09
432962538 1911 PREDICTED: uncharacterized protein LOC10 0.657 0.049 0.336 4e-09
215820598 954 RE1-silencing transcription factor [Taki 0.713 0.106 0.306 5e-09
260787879 1012 hypothetical protein BRAFLDRAFT_89170 [B 0.342 0.048 0.466 5e-09
260822986 1148 hypothetical protein BRAFLDRAFT_71748 [B 0.559 0.069 0.4 8e-09
395823003 533 PREDICTED: zinc finger protein 397 [Otol 0.468 0.125 0.375 1e-08
237511654 855 hunchback transcription factor [Artemia 0.727 0.121 0.342 1e-08
297279056 636 PREDICTED: zinc finger protein 836-like, 0.580 0.130 0.336 2e-08
449682271 330 PREDICTED: zinc finger protein 480-like 0.615 0.266 0.353 2e-08
>gi|348511898|ref|XP_003443480.1| PREDICTED: RE1-silencing transcription factor A-like [Oreochromis niloticus] Back     alignment and taxonomy information
 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 9/111 (8%)

Query: 4   DHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGH 63
           DH + KCT C           +   H +   +   P K +   C  C+Y + +  + I H
Sbjct: 271 DHRVFKCTLCPYT-------TVSQYHWRKHLRNHFPSKLHT--CSQCSYFSDRKSNYIQH 321

Query: 64  MRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYH 114
           +R HTGV+P +C  C+YS S K+ L+ H + H+G +  KC +   +A   H
Sbjct: 322 IRTHTGVRPFQCPYCDYSSSQKTHLTRHMRTHSGERPFKCESCTYLAANQH 372




Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|432961017|ref|XP_004086534.1| PREDICTED: RE1-silencing transcription factor-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|432962538|ref|XP_004086719.1| PREDICTED: uncharacterized protein LOC101162913 [Oryzias latipes] Back     alignment and taxonomy information
>gi|215820598|ref|NP_001135958.1| RE1-silencing transcription factor [Takifugu rubripes] gi|167857755|gb|ACA03866.1| NRSF/REST [Takifugu rubripes] Back     alignment and taxonomy information
>gi|260787879|ref|XP_002588979.1| hypothetical protein BRAFLDRAFT_89170 [Branchiostoma floridae] gi|229274151|gb|EEN44990.1| hypothetical protein BRAFLDRAFT_89170 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260822986|ref|XP_002603964.1| hypothetical protein BRAFLDRAFT_71748 [Branchiostoma floridae] gi|229289289|gb|EEN59975.1| hypothetical protein BRAFLDRAFT_71748 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|395823003|ref|XP_003784790.1| PREDICTED: zinc finger protein 397 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|237511654|gb|ACQ99548.1| hunchback transcription factor [Artemia sinica] Back     alignment and taxonomy information
>gi|297279056|ref|XP_002801661.1| PREDICTED: zinc finger protein 836-like, partial [Macaca mulatta] Back     alignment and taxonomy information
>gi|449682271|ref|XP_002161321.2| PREDICTED: zinc finger protein 480-like [Hydra magnipapillata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
MGI|MGI:99181 594 Zfp37 "zinc finger protein 37" 0.594 0.143 0.397 2.1e-11
UNIPROTKB|F1SAJ8 534 ZNF397 "Uncharacterized protei 0.545 0.146 0.35 2.9e-11
UNIPROTKB|G3N2L1 419 G3N2L1 "Uncharacterized protei 0.622 0.212 0.381 6.4e-11
UNIPROTKB|Q8NF99 534 ZNF397 "Zinc finger protein 39 0.650 0.174 0.365 1.6e-10
UNIPROTKB|Q8TBZ5 544 ZNF502 "Zinc finger protein 50 0.601 0.158 0.389 1.7e-10
UNIPROTKB|F1MV06 539 ZNF502 "Uncharacterized protei 0.601 0.159 0.389 2.1e-10
UNIPROTKB|J9P245 846 ZNF624 "Uncharacterized protei 0.601 0.101 0.389 2.5e-10
UNIPROTKB|Q8N8J6731 ZNF615 "Zinc finger protein 61 0.433 0.084 0.435 2.6e-10
UNIPROTKB|H9KV89736 ZNF615 "Zinc finger protein 61 0.433 0.084 0.435 2.7e-10
UNIPROTKB|F1SRB1 522 ZNF502 "Uncharacterized protei 0.601 0.164 0.389 3.3e-10
MGI|MGI:99181 Zfp37 "zinc finger protein 37" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 2.1e-11, P = 2.1e-11
 Identities = 35/88 (39%), Positives = 49/88 (55%)

Query:    18 NKLQDEELIMTHCKSCKKP-KRPDKSYNYACFIC-TYHTRKHGDMIGHMRKHTGVKPLKC 75
             +K+Q  E   +HC++  KP K P     Y C  C    + K G ++ H R HTG KP +C
Sbjct:   227 DKIQTGEKRKSHCRTPSKPEKAPGSGKPYECNHCGKVLSHKQG-LLDHQRTHTGEKPYEC 285

Query:    76 SSCNYSCSTKSALSVHQKRHTGLKAHKC 103
             + C  + S KS L VHQ+ HTG K ++C
Sbjct:   286 NECGIAFSQKSHLVVHQRTHTGEKPYEC 313


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0007281 "germ cell development" evidence=TAS
GO:0007283 "spermatogenesis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=TAS
GO:0030154 "cell differentiation" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|F1SAJ8 ZNF397 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3N2L1 G3N2L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NF99 ZNF397 "Zinc finger protein 397" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TBZ5 ZNF502 "Zinc finger protein 502" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MV06 ZNF502 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P245 ZNF624 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8J6 ZNF615 "Zinc finger protein 615" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9KV89 ZNF615 "Zinc finger protein 615" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRB1 ZNF502 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
KOG2462|consensus279 99.94
KOG2462|consensus279 99.92
KOG3608|consensus467 99.57
KOG3576|consensus267 99.55
KOG3576|consensus267 99.52
KOG3623|consensus1007 99.5
KOG3623|consensus 1007 99.5
KOG1074|consensus 958 99.49
KOG3608|consensus467 99.33
KOG1074|consensus958 99.23
PLN03086567 PRLI-interacting factor K; Provisional 99.19
PHA00733128 hypothetical protein 99.17
PHA0276855 hypothetical protein; Provisional 99.01
PLN03086567 PRLI-interacting factor K; Provisional 98.97
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.94
PHA0061644 hypothetical protein 98.87
PHA0276855 hypothetical protein; Provisional 98.62
PHA00733128 hypothetical protein 98.61
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.28
PHA0061644 hypothetical protein 98.23
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.22
PHA0073279 hypothetical protein 98.16
KOG3993|consensus500 98.16
KOG3993|consensus 500 98.11
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.02
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.01
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.98
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.69
PHA0073279 hypothetical protein 97.64
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.48
smart0035526 ZnF_C2H2 zinc finger. 97.43
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.37
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.34
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.11
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.95
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.92
COG5189423 SFP1 Putative transcriptional repressor regulating 96.91
PRK04860160 hypothetical protein; Provisional 96.85
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.7
COG5189423 SFP1 Putative transcriptional repressor regulating 96.55
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.27
smart0035526 ZnF_C2H2 zinc finger. 96.23
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.94
COG404965 Uncharacterized protein containing archaeal-type C 95.57
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.42
PRK04860160 hypothetical protein; Provisional 95.39
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.07
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.42
COG5048 467 FOG: Zn-finger [General function prediction only] 92.59
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 91.64
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 91.43
PF1371736 zinc_ribbon_4: zinc-ribbon domain 90.57
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 90.56
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 89.86
PF1371937 zinc_ribbon_5: zinc-ribbon domain 88.84
COG1198 730 PriA Primosomal protein N' (replication factor Y) 88.66
PF15135278 UPF0515: Uncharacterised protein UPF0515 88.54
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 88.1
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 87.7
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 86.19
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 86.14
KOG1146|consensus 1406 86.06
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 85.73
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 85.03
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 84.98
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 84.88
COG5048467 FOG: Zn-finger [General function prediction only] 84.52
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 83.75
KOG2186|consensus 276 83.33
KOG1146|consensus 1406 83.12
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 83.02
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 83.01
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 82.64
KOG2893|consensus 341 81.8
KOG2231|consensus 669 81.76
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 81.55
PRK06266178 transcription initiation factor E subunit alpha; V 81.47
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 81.03
PF1526954 zf-C2H2_7: Zinc-finger 80.54
>KOG2462|consensus Back     alignment and domain information
Probab=99.94  E-value=5e-27  Score=154.61  Aligned_cols=119  Identities=25%  Similarity=0.462  Sum_probs=69.9

Q ss_pred             CCccccCCcchhhhccchh---hHHHhh--------hcccCCCCCC---------CCCCcceeccCCCCccCCcchHHHh
Q psy3948           4 DHTILKCTFCNIIFNKLQD---EELIMT--------HCKSCKKPKR---------PDKSYNYACFICTYHTRKHGDMIGH   63 (143)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~---~~~~~~--------~c~~c~~~~~---------~~~~~~~~c~~c~~~~~~~~~l~~h   63 (143)
                      ....|+|+.||+.+.+..+   |+..|-        .|+.|++.|.         .+..-+++|.+||+.|.....|+.|
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcc
Confidence            4567899999999866665   443332        3555555554         1223345555555555555555555


Q ss_pred             hhhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHH
Q psy3948          64 MRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLED  122 (143)
Q Consensus        64 ~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~  122 (143)
                      +++|+|++||.|+.|+++|...++|..|+++|.+.++|+|..|++.|+..|.|.+|.+.
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            55555555555555555555555555555555555555555555555555555555543



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF15135 UPF0515: Uncharacterised protein UPF0515 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 8e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 4e-04
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 6e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 26/61 (42%), Positives = 31/61 (50%) Query: 45 YACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCA 104 YAC C + + H R HTG KP KC C S S K L+ HQ+ HTG K +KC Sbjct: 22 YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCP 81 Query: 105 N 105 Sbjct: 82 E 82
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 9e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-04
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 7e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-04
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 2e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
 Score = 63.7 bits (156), Expect = 9e-15
 Identities = 16/60 (26%), Positives = 25/60 (41%)

Query: 45  YACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCA 104
             C  C+Y       +  H R H   +P KC+ C++     S LS H K+  G  +   +
Sbjct: 10  EKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKKFHGDMSGPSS 69


>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.89
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.86
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.85
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.84
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.84
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.83
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.82
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.81
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.8
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.8
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.78
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.78
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.75
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.71
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.71
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.7
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.7
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.69
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.68
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.68
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.67
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.65
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.65
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.65
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.64
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.62
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.62
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.62
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.61
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.61
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.61
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.6
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.6
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.59
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.58
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.57
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.57
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.53
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.52
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.51
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.5
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.5
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.48
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.47
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.44
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.42
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.41
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.39
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.38
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.38
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.37
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.35
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.35
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.33
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.33
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.33
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.31
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.31
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.31
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.3
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.3
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.29
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.29
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.29
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.28
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.28
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.28
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.28
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.28
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.27
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.27
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.25
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.25
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.25
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.24
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.24
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.24
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.23
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.23
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.22
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.21
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.21
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.2
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.2
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.2
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.19
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.17
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.17
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.15
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.14
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.14
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.14
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.13
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.13
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.08
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.03
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.02
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.02
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.02
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.02
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.0
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.0
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.99
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.97
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.96
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.91
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.87
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.82
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.82
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.82
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.76
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.76
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.75
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.72
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.71
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.67
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.66
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.66
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.65
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.64
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.63
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.63
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.61
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.6
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.59
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.59
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.58
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.58
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.57
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.55
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.55
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.89
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.88
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.47
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.79
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.39
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.39
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.36
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.34
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.33
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.32
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.31
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.27
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.27
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.26
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.23
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.22
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.22
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.21
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.21
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.21
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.2
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.18
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.07
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.33
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.05
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.27
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.0
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.99
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.92
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.85
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.88
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.59
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.44
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.91
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.28
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.96
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.82
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.57
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.38
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.23
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 91.68
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 91.46
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 90.27
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.37
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 88.24
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 86.96
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 86.27
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 85.39
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.67
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 80.62
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.94  E-value=1.5e-27  Score=154.29  Aligned_cols=134  Identities=24%  Similarity=0.330  Sum_probs=104.1

Q ss_pred             CCCCccccCCcchhhhccchhhHHH---hh-----hcccCCCCCC-----------CCCCcceeccCCCCccCCcchHHH
Q psy3948           2 FVDHTILKCTFCNIIFNKLQDEELI---MT-----HCKSCKKPKR-----------PDKSYNYACFICTYHTRKHGDMIG   62 (143)
Q Consensus         2 ~~~~~~~~C~~C~~~f~~~~~~~~~---~~-----~c~~c~~~~~-----------~~~~~~~~c~~c~~~~~~~~~l~~   62 (143)
                      +.++++|.|+.|++.|.......++   +.     .|+.|++.|.           +.++++|.|+.|++.|.....|..
T Consensus        16 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~   95 (190)
T 2i13_A           16 EPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRA   95 (190)
T ss_dssp             ---------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHH
T ss_pred             cCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHH
Confidence            4567899999999999877763332   22     6999999887           355678999999999999999999


Q ss_pred             hhhhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHHhcCCCcccceee
Q psy3948          63 HMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIAL  135 (143)
Q Consensus        63 h~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~~~~~~~  135 (143)
                      |++.|.+.++|.|..|++.|.....|..|++.|++++||.|+.|++.|.+.+.|..|+++|+++++|.|....
T Consensus        96 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~  168 (190)
T 2i13_A           96 HQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECG  168 (190)
T ss_dssp             HHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTC
T ss_pred             HHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999998433



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 143
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 8e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1x5wa128 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {H 5e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.4 bits (105), Expect = 5e-08
 Identities = 12/35 (34%), Positives = 16/35 (45%)

Query: 63 HMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTG 97
             +    +  KC  C  S S  S LS H++ HTG
Sbjct: 3  SEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTG 37


>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.73
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.56
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.48
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.46
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.44
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.43
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.41
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.35
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.25
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.2
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.2
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.2
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.19
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.16
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.09
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.05
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.03
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.02
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.01
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.0
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.97
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.95
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.94
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.9
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.86
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.84
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.83
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.78
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.76
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.74
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.73
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.66
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.63
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.38
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.31
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.31
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.31
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.26
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.24
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.23
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.14
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.1
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.06
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.01
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.98
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.94
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.93
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.9
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.81
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.81
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.77
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.76
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.7
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.58
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.57
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.22
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.22
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.18
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.13
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.12
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.09
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.08
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.05
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.03
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.98
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.97
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.95
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.94
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.93
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.87
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.76
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.74
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.65
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.63
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.57
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.53
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.47
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.46
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.92
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.91
d1y0jb136 U-shaped transcription factor, different fingers { 95.77
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.67
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.59
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.45
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 95.44
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.24
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.1
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.18
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.34
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.07
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.0
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.73
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 92.12
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.02
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.81
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.44
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.36
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 90.52
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.2
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 88.2
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 85.77
d1fu9a_36 U-shaped transcription factor, different fingers { 85.36
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 82.42
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=1.2e-18  Score=88.63  Aligned_cols=53  Identities=26%  Similarity=0.243  Sum_probs=49.8

Q ss_pred             CCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHH
Q psy3948          70 VKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDI  123 (143)
Q Consensus        70 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~  123 (143)
                      ++||.|. |++.|.....|..|+++|++++||.|..||+.|+..+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            5799995 9999999999999999999999999999999999999999998765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure