Diaphorina citri psyllid: psy394


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
MSINWLHHEFVHMMNGFKRSTRLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQCYK
cccccccHHHHHHHccccccccccccccccccCEECcccccccccccccccccccccccccccccc
MSINWLHHEFVHMMNGFKRS***********GVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSINWLHHEFVHMMNGFKRSTRLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQCYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cathepsin L Important for the overall degradation of proteins in lysosomes. Essential for adult male and female fertility. May play a role in digestion.confidentQ95029
Oryzain alpha chain confidentP25776

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0030574 [BP]collagen catabolic processprobableGO:0044710, GO:0043170, GO:0008152, GO:0044707, GO:0044236, GO:0071704, GO:0032501, GO:0008150, GO:0044259, GO:0032963, GO:0044243, GO:0044699
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008234 [MF]cysteine-type peptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PCI, chain A
Confidence level:very confident
Coverage over the Query: 1-66
View the alignment between query and template
View the model in PyMOL