Psyllid ID: psy394
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| 151176971 | 339 | digestive cysteine protease [Dermestes f | 0.893 | 0.174 | 0.655 | 2e-15 | |
| 33112583 | 337 | cathepsin-L-like cysteine peptidase 03 [ | 0.893 | 0.175 | 0.559 | 2e-14 | |
| 30023547 | 337 | cathepsin L-like cysteine proteinase [Te | 0.893 | 0.175 | 0.559 | 3e-14 | |
| 33112581 | 337 | cathepsin-L-like cysteine peptidase 02 [ | 0.893 | 0.175 | 0.559 | 3e-14 | |
| 389608655 | 341 | cathepsin L [Papilio xuthus] | 0.893 | 0.173 | 0.571 | 7e-14 | |
| 91092014 | 337 | PREDICTED: similar to cathepsin-L-like c | 0.893 | 0.175 | 0.559 | 9e-14 | |
| 389610697 | 341 | cathepsin L [Papilio polytes] | 0.893 | 0.173 | 0.555 | 2e-13 | |
| 312381833 | 344 | hypothetical protein AND_05794 [Anophele | 0.893 | 0.171 | 0.560 | 5e-13 | |
| 380014284 | 345 | PREDICTED: cathepsin L-like [Apis florea | 0.893 | 0.171 | 0.566 | 8e-13 | |
| 328776427 | 351 | PREDICTED: cathepsin L-like [Apis mellif | 0.893 | 0.168 | 0.566 | 1e-12 |
| >gi|151176971|gb|ABR88030.1| digestive cysteine protease [Dermestes frischii] | Back alignment and taxonomy information |
|---|
Score = 86.7 bits (213), Expect = 2e-15, Method: Compositional matrix adjust.
Identities = 40/61 (65%), Positives = 45/61 (73%), Gaps = 2/61 (3%)
Query: 6 LHHEFVHMMNGFKRS--TRLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQ 63
LHHEFVH +NGF R+ T LLGT E+G T+IAP NVK PE VDWR GAVT +KDQG
Sbjct: 83 LHHEFVHTVNGFNRTKNTPLLGTSEDEQGATFIAPANVKFPENVDWREHGAVTXVKDQGH 142
Query: 64 C 64
C
Sbjct: 143 C 143
|
Source: Dermestes frischii Species: Dermestes frischii Genus: Dermestes Family: Dermestidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 03 [Tenebrio molitor] | Back alignment and taxonomy information |
|---|
| >gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase [Tenebrio molitor] | Back alignment and taxonomy information |
|---|
| >gi|33112581|gb|AAP94046.1| cathepsin-L-like cysteine peptidase 02 [Tenebrio molitor] | Back alignment and taxonomy information |
|---|
| >gi|389608655|dbj|BAM17937.1| cathepsin L [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|91092014|ref|XP_970644.1| PREDICTED: similar to cathepsin-L-like cysteine peptidase 02 [Tribolium castaneum] gi|270001249|gb|EEZ97696.1| cathepsin L precursor [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|389610697|dbj|BAM18960.1| cathepsin L [Papilio polytes] | Back alignment and taxonomy information |
|---|
| >gi|312381833|gb|EFR27483.1| hypothetical protein AND_05794 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|380014284|ref|XP_003691169.1| PREDICTED: cathepsin L-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328776427|ref|XP_625135.3| PREDICTED: cathepsin L-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| FB|FBgn0013770 | 371 | Cp1 "Cysteine proteinase-1" [D | 0.893 | 0.159 | 0.524 | 5e-12 | |
| ZFIN|ZDB-GENE-030131-106 | 337 | ctsl1a "cathepsin L, 1 a" [Dan | 0.803 | 0.157 | 0.431 | 1.3e-08 | |
| UNIPROTKB|F1NYJ1 | 339 | CTSL2 "Uncharacterized protein | 0.787 | 0.153 | 0.464 | 1.7e-08 | |
| WB|WBGene00000776 | 337 | cpl-1 [Caenorhabditis elegans | 0.727 | 0.142 | 0.431 | 1.3e-07 | |
| ZFIN|ZDB-GENE-071004-74 | 335 | zgc:174855 "zgc:174855" [Danio | 0.803 | 0.158 | 0.396 | 5.7e-07 | |
| UNIPROTKB|A4IFS7 | 333 | CTSL1 "CTSL1 protein" [Bos tau | 0.772 | 0.153 | 0.465 | 1.2e-06 | |
| ZFIN|ZDB-GENE-030131-572 | 335 | wu:fb37b09 "wu:fb37b09" [Danio | 0.803 | 0.158 | 0.396 | 1.2e-06 | |
| ZFIN|ZDB-GENE-041010-76 | 337 | ctsll "cathepsin L, like" [Dan | 0.803 | 0.157 | 0.413 | 1.2e-06 | |
| MGI|MGI:88564 | 334 | Ctsl "cathepsin L" [Mus muscul | 0.772 | 0.152 | 0.379 | 2.6e-06 | |
| ZFIN|ZDB-GENE-080215-7 | 336 | zgc:174153 "zgc:174153" [Danio | 0.803 | 0.157 | 0.379 | 2.6e-06 |
| FB|FBgn0013770 Cp1 "Cysteine proteinase-1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 168 (64.2 bits), Expect = 5.0e-12, P = 5.0e-12
Identities = 32/61 (52%), Positives = 42/61 (68%)
Query: 6 LHHEFVHMMNGFKRST--RLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQ 63
LHHEF +MNGF + +L + +GVT+I+P +V LP+ VDWR KGAVT +KDQG
Sbjct: 115 LHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKDQGH 174
Query: 64 C 64
C
Sbjct: 175 C 175
|
|
| ZFIN|ZDB-GENE-030131-106 ctsl1a "cathepsin L, 1 a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NYJ1 CTSL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000776 cpl-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071004-74 zgc:174855 "zgc:174855" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4IFS7 CTSL1 "CTSL1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-572 wu:fb37b09 "wu:fb37b09" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041010-76 ctsll "cathepsin L, like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88564 Ctsl "cathepsin L" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080215-7 zgc:174153 "zgc:174153" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 1e-11 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 3e-11 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 9e-11 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 2e-07 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 0.002 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 0.002 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Score = 56.4 bits (137), Expect = 1e-11
Identities = 18/22 (81%), Positives = 19/22 (86%)
Query: 43 LPEEVDWRNKGAVTPIKDQGQC 64
LPE DWR KGAVTP+KDQGQC
Sbjct: 1 LPESFDWREKGAVTPVKDQGQC 22
|
Length = 213 |
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| KOG1542|consensus | 372 | 99.88 | ||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 99.73 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 99.63 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 99.59 | |
| KOG1543|consensus | 325 | 99.48 | ||
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 99.1 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.07 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 98.96 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 98.93 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 98.87 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 98.83 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 98.76 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 98.76 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 97.99 | |
| KOG1544|consensus | 470 | 95.77 | ||
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 92.23 |
| >KOG1542|consensus | Back alignment and domain information |
|---|
Probab=99.88 E-value=2.3e-23 Score=131.32 Aligned_cols=61 Identities=36% Similarity=0.605 Sum_probs=45.1
Q ss_pred CCcCCCHHHHHHHHcCCCCC-cccccccccccceeeeCCCCCCCCCcccccccCCCCCCCcccCCCC
Q psy394 1 MSINWLHHEFVHMMNGFKRS-TRLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQCYK 66 (66)
Q Consensus 1 ~fsDlt~eEf~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~P~~~DWR~~g~Vt~Vk~Qg~CGS 66 (66)
.|||||.|||+++|++.+.. ... ..............+|++||||++|+||||||||+|||
T Consensus 119 qFSDlT~eEFkk~~l~~~~~~~~~-----~~~~~~~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGS 180 (372)
T KOG1542|consen 119 QFSDLTEEEFKKIYLGVKRRGSKL-----PGDAAEAPIEPGESLPESFDWRDKGAVTPVKNQGMCGS 180 (372)
T ss_pred chhhcCHHHHHHHhhccccccccC-----ccccccCcCCCCCCCCcccchhccCCccccccCCcCcc
Confidence 49999999999999876543 111 11111111233568999999999999999999999997
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 66 | ||||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 9e-07 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 2e-06 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 3e-06 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 4e-06 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 6e-06 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 9e-06 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 9e-06 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 1e-05 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 3e-05 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 3e-05 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 3e-05 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 3e-05 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 3e-05 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 4e-05 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 4e-05 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 5e-05 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 5e-05 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 5e-05 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 7e-05 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 9e-05 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 1e-04 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 1e-04 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 1e-04 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 1e-04 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 1e-04 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 2e-04 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 2e-04 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 2e-04 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 2e-04 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-04 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-04 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 2e-04 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 2e-04 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 2e-04 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 3e-04 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 3e-04 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 3e-04 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 3e-04 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 3e-04 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 4e-04 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 4e-04 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 4e-04 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 4e-04 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 6e-04 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 7e-04 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 7e-04 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 7e-04 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 8e-04 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 8e-04 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 8e-04 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 9e-04 |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
|
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 1e-20 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 3e-20 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 9e-20 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 9e-20 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 1e-19 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 3e-19 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 8e-19 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 3e-16 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 3e-15 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 3e-15 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 7e-14 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 2e-13 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 2e-13 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 2e-13 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 2e-13 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 2e-13 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 2e-13 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 2e-13 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 3e-13 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 3e-13 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 3e-13 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 4e-13 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 4e-13 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 8e-13 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 9e-13 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 1e-12 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 1e-12 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 1e-12 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 2e-12 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 2e-12 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 1e-11 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 3e-11 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 9e-11 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 5e-10 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 8e-10 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 1e-09 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 2e-09 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 2e-09 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 2e-07 |
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
Score = 81.1 bits (201), Expect = 1e-20
Identities = 17/60 (28%), Positives = 22/60 (36%)
Query: 5 WLHHEFVHMMNGFKRSTRLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQC 64
EF + + L T+ T N P E+D R VTPI+ QG C
Sbjct: 52 LSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGC 111
|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 99.84 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 99.81 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 99.78 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 99.78 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 99.78 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 99.78 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 99.76 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 99.71 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 99.71 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 99.67 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 99.65 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 99.6 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 99.37 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 99.36 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 99.36 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 99.36 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 99.36 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 99.34 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 99.34 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 99.34 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 99.34 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 99.34 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 99.34 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 99.34 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 99.34 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 99.33 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 99.33 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 99.33 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 99.33 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 99.33 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 99.32 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 99.31 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 99.31 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 99.3 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 99.29 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 99.21 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 99.17 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 99.05 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 98.93 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 98.64 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 97.93 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 97.8 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 97.17 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 97.05 |
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
Probab=99.84 E-value=2.1e-21 Score=123.12 Aligned_cols=63 Identities=32% Similarity=0.484 Sum_probs=45.1
Q ss_pred CCcCCCHHHHHHHHcCCCCCcccccccccccceeeeCCCCCCCCCcccccccCCCCCCCcccCCCC
Q psy394 1 MSINWLHHEFVHMMNGFKRSTRLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQCYK 66 (66)
Q Consensus 1 ~fsDlt~eEf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~DWR~~g~Vt~Vk~Qg~CGS 66 (66)
.|+|||.+||+++|++........ ..............+||++||||++|+||||||||.|||
T Consensus 113 ~FaDlT~eEf~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~lP~s~DWR~~g~VtpVkdQG~CGS 175 (363)
T 3tnx_A 113 VFADMSNDEFKEKYTGSIAGNYTT---TELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGS 175 (363)
T ss_dssp TTTTSCHHHHHHHHSCSSCSCCCC---SSSSSSCCCCCSCCCCCSCEEGGGGTCCCCCCBCCSSBC
T ss_pred ccccCCHHHHHHHhcccccccccc---cccccccccCcccCCCCcceecccCCCCCCCccCCcCCc
Confidence 599999999999998755432211 011111122233467999999999999999999999997
|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 66 | ||||
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 6e-10 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 9e-10 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 9e-10 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-09 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-09 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 1e-09 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 1e-09 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 1e-09 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 2e-09 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 3e-09 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 3e-09 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 4e-09 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 6e-09 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 2e-08 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 3e-08 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 7e-08 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 2e-07 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 5e-06 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 8e-06 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 2e-04 |
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Ervatamin C species: East indian rosebay (Ervatamia coronaria) [TaxId: 52861]
Score = 50.0 bits (118), Expect = 6e-10
Identities = 16/22 (72%), Positives = 20/22 (90%)
Query: 43 LPEEVDWRNKGAVTPIKDQGQC 64
LPE++DWR KGAVTP+K+QG C
Sbjct: 1 LPEQIDWRKKGAVTPVKNQGSC 22
|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 99.79 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 99.79 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 99.4 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 99.39 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 99.37 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 99.37 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 99.36 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 99.36 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 99.36 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.36 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 99.34 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 99.34 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 99.33 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.32 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 99.32 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 99.29 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 99.25 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 99.25 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.14 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 98.86 |
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Major mite fecal allergen der p 1 species: House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]
Probab=99.79 E-value=1.2e-20 Score=115.27 Aligned_cols=66 Identities=26% Similarity=0.209 Sum_probs=42.9
Q ss_pred CCcCCCHHHHHHHHcCCCCCcccccccccccceeeeCCCCCCCCCcccccccCCCCCCCcccCCCC
Q psy394 1 MSINWLHHEFVHMMNGFKRSTRLLGTERVEEGVTYIAPDNVKLPEEVDWRNKGAVTPIKDQGQCYK 66 (66)
Q Consensus 1 ~fsDlt~eEf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~DWR~~g~Vt~Vk~Qg~CGS 66 (66)
.|+|||.+||..+++..........................++|++||||++|+||||||||.|||
T Consensus 45 ~fsDlt~eEf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~DwR~~g~vtpVkdQG~CGs 110 (302)
T d1xkga1 45 HLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGS 110 (302)
T ss_dssp TTTTSCHHHHHHHHSBCHHHHHHHHHHHC-----CBCCCCSCCCSCEETTTTTCCCCCCBCCSSBC
T ss_pred cCCCCCHHHHHHHhcCCCcccccccccCCCCccccccccCCCCCcceeccccCccccceeccccce
Confidence 499999999999886543221100000000111112233467999999999999999999999997
|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|