Diaphorina citri psyllid: psy3959


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MVVNDNKGFWKKNSHNVPGRPSPKKSVFSSSSQSNANSSFQAYQASISDAWVIDDDEFCSPNVNISKKVAQSAALNVINNHKTKQFETSSSSRNSKVNESESSKIAKFNALLNLNLLNLEELRSLAWSGIPNQVRPDAWRLLAGYLPTSSERRQQVLERKRTEYWVFVKQYYDTDRDETYQDIYRQIHIDIPRMSPLMMLFQQKLVQEMFERILFIWAIRHPASGYVQGINDLVTPFFVVFLQEFLPVGTDLEQLDLSTLPKEQRDIIEADSFCCLSKFLDGIQDNYIFAQLGIQQKVNQLKDLIQRIDTNLHNHLLKHGVDYLQFSFRWMNNLLTREVPLRCSIRLWDTYLAESDDFAAFQLYVCAAFLLHWRQKLLRERDFQGLMLMLQNLPTSNWSDHDIGVLVAEAYRLKVAFADAPNHLSGSKTKR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccHHHHcHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccccc
********************************************************************************************************IAKFNALLNLNLLNLEELRSLAWSGIPNQVRPDAWRLLAGYLPTSSERRQQVLERKRTEYWVFVKQYYDTDRDETYQDIYRQIHIDIPRMSPLMMLFQQKLVQEMFERILFIWAIRHPASGYVQGINDLVTPFFVVFLQEFLPVGTDLEQLDLSTLPKEQRDIIEADSFCCLSKFLDGIQDNYIFAQLGIQQKVNQLKDLIQRIDTNLHNHLLKHGVDYLQFSFRWMNNLLTREVPLRCSIRLWDTYLAESDDFAAFQLYVCAAFLLHWRQKLLRERDFQGLMLMLQNLPTSNWSDHDIGVLVAEAYRLKVAFAD************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVNDNKGFWKKNSHNVPGRPSPKKSVFSSSSQSNANSSFQAYQASISDAWVIDDDEFCSPNVNISKKVAQSAALNVINNHKTKQFETSSSSRNSKVNESESSKIAKFNALLNLNLLNLEELRSLAWSGIPNQVRPDAWRLLAGYLPTSSERRQQVLERKRTEYWVFVKQYYDTDRDETYQDIYRQIHIDIPRMSPLMMLFQQKLVQEMFERILFIWAIRHPASGYVQGINDLVTPFFVVFLQEFLPVGTDLEQLDLSTLPKEQRDIIEADSFCCLSKFLDGIQDNYIFAQLGIQQKVNQLKDLIQRIDTNLHNHLLKHGVDYLQFSFRWMNNLLTREVPLRCSIRLWDTYLAESDDFAAFQLYVCAAFLLHWRQKLLRERDFQGLMLMLQNLPTSNWSDHDIGVLVAEAYRLKVAFADAPNHLSGSKTKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TBC1 domain family member 22B May act as a GTPase-activating protein for Rab family protein(s).confidentQ9NU19
GTPase-activating protein gyp1 Stimulates specifically the GTPase activity of ypt1. Functions on the Golgi as a negative regulator of ypt1.confidentO59737

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032313 [BP]regulation of Rab GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0048583, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0032483, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:0051174, GO:1900542, GO:0006140
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005097 [MF]Rab GTPase activator activityprobableGO:0005099, GO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QFZ, chain A
Confidence level:very confident
Coverage over the Query: 103-417
View the alignment between query and template
View the model in PyMOL