Diaphorina citri psyllid: psy3965


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----
MSSDKMGADTVSNSTATPSNEKPPSSPVTTNEDPISNAIGEFGRWQFQLTVLLSLLNIPCTWHIFALTFQAADQNFWCAQTDNFDHISFPEWINISGVFTRDDEKFGYNPCAIKDLDYSQSYHDLLLESENVTTTRPCQKWLYDTNNFGDTIISEPESHSYEMQSDFDVQLSKLYTGQSNLDDTGSRFGRKRALMGSLVCQLVLGAGVAASPWFEGYLVLRAMLGFVCVSIVFSGFVLCMEIVGGKWLTIAGISYLFPVPLGYIAISGIAYYIHSWRILQWVITAPTIIFLILWWCIPESPRWLLTMGKTEEAMEVLKDAARFNDKTLPANTDKLLKQSVSSMKEDSGKKVEVLDLWRTPLMRLISCVQYVVWFSVYLVYYGLVLNLSNIGGDVYVNTVISGESFNSTTLSTSSILCFHDLSTSCVPGIVEIPAIAMSILILLKMGRRRPLCLTTMAAGVACLVTLAFPQGSWMTISLAMIGKFAISSSNVVMPVYTAELFPTKMRNLGVGASSVPAGVALILIPYLWDMVNSFT
cccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEccccccccEEEcccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHcHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHEEEEccccccccHHHHHHHccccccccccccccccccccccccccccEEccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*********************************PISNAIGEFGRWQFQLTVLLSLLNIPCTWHIFALTFQAADQNFWCAQTDNFDHISFPEWINISGVFTRDDEKFGYNPCAIKDLDYSQSYHDLLLESENVTTTRPCQKWLYDTNNFGDTIISEPESHSYEMQSDFDVQLSKLYTGQSNLDDTGSRFGRKRALMGSLVCQLVLGAGVAASPWFEGYLVLRAMLGFVCVSIVFSGFVLCMEIVGGKWLTIAGISYLFPVPLGYIAISGIAYYIHSWRILQWVITAPTIIFLILWWCIPESPRWLLTMGKTEEAMEVLKDAARFNDKTLPANT******************VEVLDLWRTPLMRLISCVQYVVWFSVYLVYYGLVLNLSNIGGDVYVNTVISGESFNSTTLSTSSILCFHDLSTSCVPGIVEIPAIAMSILILLKMGRRRPLCLTTMAAGVACLVTLAFPQGSWMTISLAMIGKFAISSSNVVMPVYTAELFPTKMRNLGVGASSVPAGVALILIPYLWDMVNSFT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDKMGADTVSNSTATPSNEKPPSSPVTTNEDPISNAIGEFGRWQFQLTVLLSLLNIPCTWHIFALTFQAADQNFWCAQTDNFDHISFPEWINISGVFTRDDEKFGYNPCAIKDLDYSQSYHDLLLESENVTTTRPCQKWLYDTNNFGDTIISEPESHSYEMQSDFDVQLSKLYTGQSNLDDTGSRFGRKRALMGSLVCQLVLGAGVAASPWFEGYLVLRAMLGFVCVSIVFSGFVLCMEIVGGKWLTIAGISYLFPVPLGYIAISGIAYYIHSWRILQWVITAPTIIFLILWWCIPESPRWLLTMGKTEEAMEVLKDAARFNDKTLPANTDKLLKQSVSSMKEDSGKKVEVLDLWRTPLMRLISCVQYVVWFSVYLVYYGLVLNLSNIGGDVYVNTVISGESFNSTTLSTSSILCFHDLSTSCVPGIVEIPAIAMSILILLKMGRRRPLCLTTMAAGVACLVTLAFPQGSWMTISLAMIGKFAISSSNVVMPVYTAELFPTKMRNLGVGASSVPAGVALILIPYLWDMVNSFT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Solute carrier family 22 member 2 Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, serotonin, choline, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP and amiloride (By similarity). Mediates the influx of adrenaline, noradrenaline (norepinephrine), dopamine, cimetidine, famotidine, metformin, N-1-methylnicotinamide (NMN), 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), oxaliplatin and cisplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.confidentQ9R0W2
Solute carrier family 22 member 2 Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), 1-methyl-4-phenylpyridinium (MPP), cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity (By similarity). Mediates tubular uptake of tetraethylammonium (TEA) and cimetidine.confidentQ8MJI6
Solute carrier family 22 member 2 Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.confidentO15244

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0015651 [MF]quaternary ammonium group transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0015101, GO:0003674
GO:0015850 [BP]organic hydroxy compound transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0008509 [MF]anion transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:1901618 [MF]organic hydroxy compound transmembrane transporter activityprobableGO:0005215, GO:0022857, GO:0003674
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0015695 [BP]organic cation transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015697 [BP]quaternary ammonium group transportprobableGO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0046942 [BP]carboxylic acid transportprobableGO:0015849, GO:0006811, GO:0006810, GO:0006820, GO:0015711, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015297 [MF]antiporter activityprobableGO:0005215, GO:0022857, GO:0015291, GO:0003674, GO:0022804
GO:0015893 [BP]drug transportprobableGO:0050896, GO:0006810, GO:0042493, GO:0044765, GO:0008150, GO:0042221, GO:0051234, GO:0051179, GO:0044699
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 159-399,423-530
View the alignment between query and template
View the model in PyMOL
Template: 3O7Q, chain A
Confidence level:confident
Coverage over the Query: 149-304,341-402,426-533
View the alignment between query and template
View the model in PyMOL