Diaphorina citri psyllid: psy3967

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----

MPPLRNNIVTHLPPTNMNDNRSTSTLLDKCSRKQNMTLECDRLDSFKNSWPLTYLSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGKWVQGDDPLKDHEKWSPNCWFLRRLKKGNTESAGYDTCGSLIIEPPKSKSEVSQSCSQPNQVVSSLEKLGIHKNSPPAFPNYATYESRLRSFDSWPISLRLKPVTLTEAGFFYTGKADQTLCFRCGGGLKHWEETDDPWTEHARWFSSCPYVKLVKGQEFINQVIGHKEVANDPITLQPLHYIAETSTAVKPTACSQDDKRPEPNSDGRLCKICYQREMGVVFLPCGHIVACVI

ccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccHHHHHHcccEEcccccccccccCEEEECcccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccHHHHHcccccccccccccccccccccEEECcccccEEEcccccccccccccccHHHHHHHHcccccccHHccccccccEEcccccccccccccccccccccccccccccccccccccccccccccHHHHcccCEEcEEEEccccEEEEEc

*P*********************************MTLECDRLDSFKNSWPLTYLSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGKWVQGDDPLKDHEKWSPNCWFLRRLKKGNTESAGYDTCGSLIIEPP*****************SSLEKLGIHKNSPPAFPNYATYESRLRSFDSWPISLRLKPVTLTEAGFFYTGKADQTLCFRCGGGLKHWEETDDPWTEHARWFSSCPYVKLVKGQEFINQVIGHKEVANDPITLQPLHYIAETST********Q*DKRPEPNSDGRLCKICYQREMGVVFLPCGHIVACVI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Apoptosis 1 inhibitor	Anti-apoptotic protein which functions as a caspase regulator, using its E3 ubiquitin-protein ligase activity to smother caspase activity. Binds, ubiquitinates and inactivates initator caspase Nc, and effector caspases ICE and DCP-1. Acts as a NEDD8-E3 ubiquitin-protein ligase for ICE. Suppresses apoptosis by targeting the apoptosome for ubiquitination and inactivation. Plays an important role in cell motility. Overexpression suppresses rpr and W-dependent cell death in the eye. Interaction of th with Nc is required to suppress Nc-mediated cell death; th-mediated ubiquitination of Nc. Acts as a positive regulator of Wnt signaling.	confident	Q24306

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0072557 [CC]	IPAF inflammasome complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004842 [MF]	ubiquitin-protein ligase activity	probable	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0006464 [BP]	cellular protein modification process	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0012501 [BP]	programmed cell death	probable	GO:0010259, GO:0009987, GO:0008150, GO:0044763, GO:0007569, GO:0044699
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0005694 [CC]	chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SIQ, chain A
Confidence level:very confident
Coverage over the Query: 32-123
View the alignment between query and template
View the model in PyMOL

Template: 3T6P, chain A
Confidence level:very confident
Coverage over the Query: 35-134,147-323
View the alignment between query and template
View the model in PyMOL