Diaphorina citri psyllid: psy3978

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---

MIRRSSYGNRSQSRGTDYSMGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGPEL

cccccccccccccccccccccccccccccccccccccccHHHHccccEEEEEcccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccEEEcEEcccccccccEEEEEEcccccccEEECccccccccccccccccccccHHHHHHcccccccccHHHHHHcccHHHHHHHccccccccccccEEEcccccccc

**********************************KHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGP**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
RING finger protein 10		confident	Q08E13
RING finger protein 10	Transcriptional factor involved in the regulation of MAG expression. Participates in the peripheral nerve development and Schawnn cell differentiation.	confident	Q8N5U6
RING finger protein 10	Transcriptional factor involved in the regulation of MAG expression. Participates in the peripheral nerve development and expression.	confident	Q3UIW5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044212 [MF]	transcription regulatory region DNA binding	probable	GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0010626 [BP]	negative regulation of Schwann cell proliferation	probable	GO:0032502, GO:0030154, GO:0060284, GO:0050789, GO:0044699, GO:0010624, GO:0014014, GO:0050767, GO:0014013, GO:0048869, GO:0050768, GO:0007275, GO:0065007, GO:0010721, GO:0048519, GO:0042127, GO:0008285, GO:0032501, GO:0050793, GO:0009987, GO:0060251, GO:0060253, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JM7, chain A
Confidence level:very confident
Coverage over the Query: 69-142
View the alignment between query and template
View the model in PyMOL

Template: 2JUN, chain A
Confidence level:probable
Coverage over the Query: 83-180
View the alignment between query and template
View the model in PyMOL