Psyllid ID: psy3978


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MIRRSSYGNRSQSRGTDYSMGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGPEL
cccccccccccccccccccccccccccccccccccccccHHHHccccEEEEEcccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccEEEcEEcccccccccEEEEEEcccccccEEEEccccccccccccccccccccHHHHHHcccccccccHHHHHHcccHHHHHHHccccccccccccEEEcccccccc
cccccccccccccccccccccccccccccccccccccccHHHHEEEEEEEEEccccccccccccccccccHHHEEEEEEEccccccccccccccccccccccccEEcHHHHHHHHcccccccccccccccHEcHHcccEEEEEEccccccccEEEEEEEEcccccEEEccccccccccccccccccHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccc
mirrssygnrsqsrgtdysmgYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGedygihlgdpdqlVKWEYIQQIRgfgnedikcpicldlprapqmtrcghcfcwpcilhylalsdkswrkcpicyeavhlgdlKSFRSVIKRARAVNEEVTFQLMkrergstvvspvaqwdfhptdmlMNVSAKCNAYIAInldypaiapIFSVqlelpgkliktvhnddavrcCDSFLIQFIQGGPEL
mirrssygnrsqsrgtdysMGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVneevtfqlmkrergstvvspvAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGPEL
MIRRSSYGNRSQSRGTDYSMGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGPEL
*******************MGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQ*****
******************************************FLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLAL**KSWRKCPICYEAVHLGDLKSFRSVIKRAR*************************************SAKCNAYIAINLDYPAIAPIFSVQLE************DAVRCCDSFLIQFIQGGP**
**************GTDYSMGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGPEL
**********************************KHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGPEL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRRSSYGNRSQSRGTDYSMGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDMLMNVSAKCNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHNDDAVRCCDSFLIQFIQGGPEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q3UIW5 804 RING finger protein 10 OS yes N/A 0.572 0.172 0.557 9e-43
Q08E13 810 RING finger protein 10 OS yes N/A 0.572 0.171 0.55 2e-42
Q8N5U6 811 RING finger protein 10 OS yes N/A 0.572 0.171 0.542 2e-41
Q32NQ8 756 RING finger protein 10 OS N/A N/A 0.563 0.181 0.525 4e-41
Q5XI59 802 RING finger protein 10 OS yes N/A 0.572 0.173 0.535 7e-41
O94271 673 Uncharacterized RING fing yes N/A 0.707 0.255 0.299 1e-13
Q5D7I0 494 Tripartite motif-containi N/A N/A 0.308 0.151 0.35 1e-06
Q5BN31 494 Tripartite motif-containi N/A N/A 0.304 0.149 0.354 1e-06
Q8GUK7243 E3 ubiquitin-protein liga no N/A 0.242 0.242 0.373 9e-06
Q1ACD7 494 Tripartite motif-containi no N/A 0.279 0.137 0.315 1e-05
>sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 Back     alignment and function desciption
 Score =  173 bits (439), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 78/140 (55%), Positives = 98/140 (70%), Gaps = 1/140 (0%)

Query: 36  HK-YNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLP 94
           HK +NKE FLQANCQFVV   +DY  H  DPD LV W++++Q+R   +E   CPICL  P
Sbjct: 173 HKPFNKELFLQANCQFVVSEDQDYAAHFADPDTLVNWDFVEQVRICSHEVPSCPICLYPP 232

Query: 95  RAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEV 154
            A ++TRCGH FCW CILHYL+LS+K+W KCPICY +VH  DLKS  +   R  AV + +
Sbjct: 233 TAAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKSVVATESRQYAVGDTI 292

Query: 155 TFQLMKRERGSTVVSPVAQW 174
           T QLMKRE+G  V  P ++W
Sbjct: 293 TMQLMKREKGVLVALPKSKW 312




Transcriptional factor involved in the regulation of MAG expression. Participates in the peripheral nerve development and expression.
Mus musculus (taxid: 10090)
>sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1 Back     alignment and function description
>sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2 Back     alignment and function description
>sp|Q32NQ8|RNF10_XENLA RING finger protein 10 OS=Xenopus laevis GN=rnf10 PE=2 SV=1 Back     alignment and function description
>sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1 Back     alignment and function description
>sp|O94271|YORN_SCHPO Uncharacterized RING finger protein P8B7.23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.23 PE=4 SV=1 Back     alignment and function description
>sp|Q5D7I0|TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus GN=TRIM5 PE=3 SV=1 Back     alignment and function description
>sp|Q5BN31|TRIM5_SAIBB Tripartite motif-containing protein 5 OS=Saimiri boliviensis boliviensis GN=TRIM5 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUK7|RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana GN=RMA3 PE=1 SV=1 Back     alignment and function description
>sp|Q1ACD7|TRIM5_NOMLE Tripartite motif-containing protein 5 OS=Nomascus leucogenys GN=TRIM5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
156543195 731 PREDICTED: RING finger protein 10-like [ 0.876 0.291 0.460 5e-49
260803627 696 hypothetical protein BRAFLDRAFT_219134 [ 0.683 0.238 0.566 1e-47
260829271 834 hypothetical protein BRAFLDRAFT_115063 [ 0.683 0.199 0.566 2e-47
242013533 730 RING finger protein, putative [Pediculus 0.691 0.230 0.529 9e-47
312378057 791 hypothetical protein AND_10478 [Anophele 0.827 0.254 0.472 5e-46
328783042 695 PREDICTED: RING finger protein 10-like [ 0.753 0.263 0.468 5e-45
170030316 762 RING finger protein 10 [Culex quinquefas 0.625 0.199 0.577 6e-45
380013198 710 PREDICTED: RING finger protein 10-like [ 0.753 0.257 0.468 6e-45
383860120 721 PREDICTED: RING finger protein 10-like [ 0.666 0.224 0.512 3e-44
410922311 765 PREDICTED: RING finger protein 10-like [ 0.584 0.185 0.587 4e-44
>gi|156543195|ref|XP_001606231.1| PREDICTED: RING finger protein 10-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 139/226 (61%), Gaps = 13/226 (5%)

Query: 4   RSSYGNRSQSRGTDY-SMGYNNFLMQSLASVHKHKYNKEQFLQANCQFVVRLGEDYGIHL 62
           R   G  S  R + Y S  YN +L     +V +HKYNKEQFLQANCQFVV    DY ++L
Sbjct: 116 RDVQGGWSHGRASGYNSHHYNRWL----PAVQRHKYNKEQFLQANCQFVVTAKGDYSLYL 171

Query: 63  GDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSW 122
            DPD LV W+ IQQIR   ++++ CPICL  P A +MTRCGH +CWPCILHYLALSDKSW
Sbjct: 172 NDPDILVDWKLIQQIRVHSSDNLSCPICLCPPVAGKMTRCGHVYCWPCILHYLALSDKSW 231

Query: 123 RKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERGSTVVSPVAQWDFHPTDML 182
           RKCPICYE++H  DLKS   + + A  + + ++ +LM+RE+G+ +  PV   +  P    
Sbjct: 232 RKCPICYESIHKSDLKSVVEITENALNIGDNISLRLMRREKGTLIAVPVNDIESAPPSTF 291

Query: 183 MNVSAK------CNAYIAINLDYPAIAPIFSVQLELPGKLIKTVHN 222
           ++VS            +A N D   I     VQL+L  +L++  H+
Sbjct: 292 LSVSENSCQQVYSKLLLAQNADIMDIIESERVQLKL--ELLEDPHS 335




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|260803627|ref|XP_002596691.1| hypothetical protein BRAFLDRAFT_219134 [Branchiostoma floridae] gi|229281950|gb|EEN52703.1| hypothetical protein BRAFLDRAFT_219134 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260829271|ref|XP_002609585.1| hypothetical protein BRAFLDRAFT_115063 [Branchiostoma floridae] gi|229294947|gb|EEN65595.1| hypothetical protein BRAFLDRAFT_115063 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|242013533|ref|XP_002427459.1| RING finger protein, putative [Pediculus humanus corporis] gi|212511845|gb|EEB14721.1| RING finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|312378057|gb|EFR24732.1| hypothetical protein AND_10478 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|328783042|ref|XP_392932.3| PREDICTED: RING finger protein 10-like [Apis mellifera] Back     alignment and taxonomy information
>gi|170030316|ref|XP_001843035.1| RING finger protein 10 [Culex quinquefasciatus] gi|167866927|gb|EDS30310.1| RING finger protein 10 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|380013198|ref|XP_003690653.1| PREDICTED: RING finger protein 10-like [Apis florea] Back     alignment and taxonomy information
>gi|383860120|ref|XP_003705539.1| PREDICTED: RING finger protein 10-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|410922311|ref|XP_003974626.1| PREDICTED: RING finger protein 10-like [Takifugu rubripes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
ZFIN|ZDB-GENE-030131-2969 778 rnf10 "ring finger protein 10" 0.580 0.181 0.577 3.6e-42
MGI|MGI:1859162 804 Rnf10 "ring finger protein 10" 0.596 0.180 0.54 1.1e-40
UNIPROTKB|F1N8N9 830 RNF10 "Uncharacterized protein 0.572 0.167 0.542 1.2e-40
UNIPROTKB|Q08E13 810 RNF10 "RING finger protein 10" 0.572 0.171 0.55 2.4e-40
UNIPROTKB|J9PBL6 749 RNF10 "Uncharacterized protein 0.572 0.185 0.542 3.6e-40
FB|FBgn0035232 708 CG12099 [Drosophila melanogast 0.559 0.192 0.562 4.5e-40
UNIPROTKB|E2RE56 961 RNF10 "Uncharacterized protein 0.572 0.144 0.542 8.4e-40
UNIPROTKB|Q8N5U6 811 RNF10 "RING finger protein 10" 0.572 0.171 0.542 2.3e-39
UNIPROTKB|Q32NQ8 756 rnf10 "RING finger protein 10" 0.563 0.181 0.525 6e-39
RGD|1309282 802 Rnf10 "ring finger protein 10" 0.572 0.173 0.535 7.6e-39
ZFIN|ZDB-GENE-030131-2969 rnf10 "ring finger protein 10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 453 (164.5 bits), Expect = 3.6e-42, P = 3.6e-42
 Identities = 82/142 (57%), Positives = 99/142 (69%)

Query:    34 HKHK-YNKEQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLD 92
             HKHK +NKE FLQANCQFVV   +DY  H  DPD LV W+ +QQ+R + +E   CPICL 
Sbjct:   168 HKHKPFNKELFLQANCQFVVSDDQDYQAHFTDPDTLVDWDCVQQVRIYSHEVPSCPICLY 227

Query:    93 LPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKRARAVNE 152
              P A  MTRCGH +CWPC+LHYL+LS+KSW KCPICYEAVH  DLKS  ++  R      
Sbjct:   228 PPVAAHMTRCGHIYCWPCMLHYLSLSEKSWSKCPICYEAVHSADLKSVVAMETRQYVSGN 287

Query:   153 EVTFQLMKRERGSTVVSPVAQW 174
              +T  LM+RE+GS V  P +QW
Sbjct:   288 SITMCLMRREKGSLVALPSSQW 309




GO:0008270 "zinc ion binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
MGI|MGI:1859162 Rnf10 "ring finger protein 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8N9 RNF10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E13 RNF10 "RING finger protein 10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9PBL6 RNF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0035232 CG12099 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE56 RNF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N5U6 RNF10 "RING finger protein 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q32NQ8 rnf10 "RING finger protein 10" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
RGD|1309282 Rnf10 "ring finger protein 10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3UIW5RNF10_MOUSENo assigned EC number0.55710.57200.1728yesN/A
Q5XI59RNF10_RATNo assigned EC number0.53570.57200.1733yesN/A
Q08E13RNF10_BOVINNo assigned EC number0.550.57200.1716yesN/A
Q8N5U6RNF10_HUMANNo assigned EC number0.54280.57200.1713yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 2e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 3e-09
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-08
PLN03208193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 5e-08
smart0018440 smart00184, RING, Ring finger 2e-07
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-05
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 5e-05
COG5222427 COG5222, COG5222, Uncharacterized conserved protei 7e-05
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 7e-05
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 1e-04
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 0.001
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score = 58.8 bits (142), Expect = 2e-10
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query: 74  IQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVH 133
              +      D KC +CL+ P  P  T CGH FC  C+L  ++ + K +  CP+C   V+
Sbjct: 205 KNGLPFIPLADYKCFLCLEEPEVPSCTPCGHLFCLSCLL--ISWTKKKYEFCPLCRAKVY 262

Query: 134 LGD 136
              
Sbjct: 263 PKK 265


Length = 271

>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG2164|consensus 513 99.78
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.46
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.38
KOG0823|consensus230 99.37
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.3
KOG0317|consensus293 99.22
KOG0287|consensus 442 99.21
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.2
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.13
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.13
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.1
KOG0320|consensus187 99.1
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.1
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.05
PHA02929238 N1R/p28-like protein; Provisional 99.05
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.02
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.98
PHA02926242 zinc finger-like protein; Provisional 98.9
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.89
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.86
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.83
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.82
KOG2177|consensus 386 98.82
PF1463444 zf-RING_5: zinc-RING finger domain 98.77
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.74
KOG0978|consensus698 98.64
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.54
KOG4628|consensus348 98.4
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.39
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.38
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.35
KOG0802|consensus543 98.28
KOG0311|consensus 381 98.22
KOG0824|consensus 324 98.16
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.03
KOG4159|consensus 398 98.02
KOG2660|consensus 331 98.02
KOG4172|consensus62 98.0
KOG2879|consensus298 97.97
COG5222427 Uncharacterized conserved protein, contains RING Z 97.96
COG5152259 Uncharacterized conserved protein, contains RING a 97.77
KOG4692|consensus489 97.66
KOG1002|consensus791 97.65
KOG0804|consensus 493 97.58
KOG0297|consensus 391 97.56
KOG1645|consensus 463 97.53
KOG1813|consensus313 97.49
KOG4265|consensus349 97.31
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.29
KOG0828|consensus636 97.26
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.14
KOG1785|consensus563 97.09
KOG1039|consensus344 97.08
KOG0827|consensus 465 97.02
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.98
KOG1734|consensus328 96.81
COG52191525 Uncharacterized conserved protein, contains RING Z 96.63
KOG4367|consensus 699 96.57
KOG3039|consensus303 96.5
KOG4275|consensus350 96.5
KOG1493|consensus84 96.5
KOG1001|consensus674 96.48
KOG0825|consensus 1134 96.34
KOG1571|consensus355 96.29
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.06
KOG4185|consensus 296 96.03
PF04641260 Rtf2: Rtf2 RING-finger 95.98
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.86
KOG0826|consensus357 95.79
KOG3800|consensus 300 95.76
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.74
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.62
KOG2930|consensus114 95.61
KOG1941|consensus518 95.27
KOG4739|consensus233 94.97
KOG4362|consensus 684 94.68
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.54
KOG3161|consensus 861 94.43
KOG1814|consensus445 94.4
KOG3002|consensus299 94.35
KOG2817|consensus394 94.04
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.79
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 93.57
PHA03096284 p28-like protein; Provisional 93.54
KOG4445|consensus368 93.51
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.6
KOG2932|consensus 389 92.57
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.36
KOG2114|consensus933 92.22
KOG3039|consensus 303 92.13
KOG0298|consensus1394 91.91
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 91.18
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 91.17
KOG1428|consensus3738 90.93
PHA02825162 LAP/PHD finger-like protein; Provisional 90.29
KOG3970|consensus299 90.04
PF10272358 Tmpp129: Putative transmembrane protein precursor; 89.2
KOG1940|consensus276 88.41
KOG3579|consensus352 88.1
KOG3899|consensus381 87.68
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 87.55
KOG1952|consensus 950 87.06
COG5109396 Uncharacterized conserved protein, contains RING Z 86.9
KOG1812|consensus384 86.89
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 84.82
KOG3268|consensus234 84.45
PHA02862156 5L protein; Provisional 84.27
KOG1815|consensus 444 83.93
KOG2169|consensus 636 83.62
KOG1100|consensus207 82.37
COG381384 Uncharacterized protein conserved in bacteria [Fun 80.4
>KOG2164|consensus Back     alignment and domain information
Probab=99.78  E-value=1.2e-19  Score=165.76  Aligned_cols=116  Identities=41%  Similarity=0.757  Sum_probs=98.6

Q ss_pred             hhhhccceeEEEcCCCcccccCCCCcccCChhhHhhhhccCCCCccccccCCCCCCcEEcCCCccccHHHHHHHHHhC-C
Q psy3978          41 EQFLQANCQFVVRLGEDYGIHLGDPDQLVKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALS-D  119 (243)
Q Consensus        41 ~~~~~~n~~f~v~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~CpICl~~~~~p~~~~CgH~FC~~Ci~~~~~~~-~  119 (243)
                      +.|++|||+|+|. .++|.....+||.+++|+++.++....  +..||||++.+..|+++.|||.||+.||.+||... .
T Consensus       146 q~f~~any~fvv~-~gd~~~qn~dpD~p~~~e~i~qv~~~t--~~~CPICL~~~~~p~~t~CGHiFC~~CiLqy~~~s~~  222 (513)
T KOG2164|consen  146 QTFLNANYRFVVD-EGDYVLQNTDPDAPVDWEDIFQVYGST--DMQCPICLEPPSVPVRTNCGHIFCGPCILQYWNYSAI  222 (513)
T ss_pred             hhhhccchheeec-ccchhhhccCCccccchHHhhhhhcCc--CCcCCcccCCCCcccccccCceeeHHHHHHHHhhhcc
Confidence            3799999999999 999999999999999999999976443  89999999999999999999999999999999987 3


Q ss_pred             CCCCCCCCCCccccCCCCcchhHHHHhhhccCccceeeeeeecCC
Q psy3978         120 KSWRKCPICYEAVHLGDLKSFRSVIKRARAVNEEVTFQLMKRERG  164 (243)
Q Consensus       120 ~~~~~CP~Cr~~~~~~~l~~~~~~~~~~~~~~~~~~l~l~~r~~~  164 (243)
                      ..+..||+|+..+..+++.++.......     ...++++++..|
T Consensus       223 ~~~~~CPiC~s~I~~kdl~pv~~e~~qk-----ke~l~~~~~~ng  262 (513)
T KOG2164|consen  223 KGPCSCPICRSTITLKDLLPVFIEDDQK-----KEELKLHQDPNG  262 (513)
T ss_pred             cCCccCCchhhhccccceeeeeeccccc-----cHHHHHHhcccC
Confidence            4557999999999999999988765521     112555555554



>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>KOG2169|consensus Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1jm7_A112 Solution Structure Of The Brca1/bard1 Ring-domain H 2e-05
2ecv_A85 Solution Structure Of The Zinc Finger, C3hc4 Type ( 4e-05
2ysl_A73 Solution Structure Of The Ring Domain (1-66) From T 4e-05
2ysj_A63 Solution Structure Of The Ring Domain (1-56) From T 1e-04
2ecw_A85 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-04
>pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 69 VKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPIC 128 ++ E +Q + + ++CPICL+L + P T+C H FC C+L L K +CP+C Sbjct: 6 LRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLN-QKKGPSQCPLC 64
>pdb|2ECV|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Tripartite Motif-Containing Protein 5 Length = 85 Back     alignment and structure
>pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 Back     alignment and structure
>pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 Back     alignment and structure
>pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-12
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-12
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 5e-12
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-11
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-11
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-11
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 3e-11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 4e-11
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 5e-11
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 5e-11
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 6e-11
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 7e-11
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-10
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-10
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-10
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-10
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-10
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 3e-10
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 3e-10
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-09
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-09
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-09
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-09
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 6e-09
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-08
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-08
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 2e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-08
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-08
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 4e-08
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-07
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 5e-07
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 9e-06
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 2e-05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 4e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 5e-05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 5e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 6e-04
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 6e-04
3nw0_A238 Non-structural maintenance of chromosomes element 7e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 7e-04
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
 Score = 61.1 bits (148), Expect = 2e-12
 Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 4/63 (6%)

Query: 82  NEDIKCPICLDLPRAPQM-TRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSF 140
            E  +C IC++  R  ++   C    C+ CI  +L         CP C   + L +L + 
Sbjct: 20  AEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQ---CPHCRAPLQLRELVNC 76

Query: 141 RSV 143
           R  
Sbjct: 77  RWA 79


>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.56
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.52
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.5
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.5
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.49
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.48
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.48
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.47
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.46
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.45
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.45
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.45
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.45
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.44
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.43
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.43
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.42
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.42
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.42
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.41
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.41
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.4
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.4
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.39
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.39
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.38
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.38
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.37
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.37
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.36
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.36
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.35
2ect_A78 Ring finger protein 126; metal binding protein, st 99.32
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.3
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.3
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.29
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.29
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.29
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.28
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.27
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.27
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.26
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.25
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.25
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.23
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.22
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.22
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.21
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.2
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.17
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.15
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.09
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.09
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.05
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.04
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.03
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.01
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.0
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.97
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.96
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.82
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.81
2ea5_A68 Cell growth regulator with ring finger domain prot 98.8
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.71
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.7
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.62
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.3
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.29
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.13
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.73
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 97.45
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 96.66
3nw0_A238 Non-structural maintenance of chromosomes element 96.3
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.91
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 91.66
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 91.19
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 86.7
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
Probab=99.56  E-value=3.4e-15  Score=105.23  Aligned_cols=62  Identities=23%  Similarity=0.422  Sum_probs=54.6

Q ss_pred             CCCCccccccCCCCCCcEEcCCCccccHHHHHHHHHhCCCCCCCCCCCCccccCCCCcchhHHHH
Q psy3978          81 GNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIK  145 (243)
Q Consensus        81 ~~~~~~CpICl~~~~~p~~~~CgH~FC~~Ci~~~~~~~~~~~~~CP~Cr~~~~~~~l~~~~~~~~  145 (243)
                      ..+++.||||++.+.+|++++|||+||..||.+|+..+.   ..||+|+..+...++.++..+..
T Consensus         5 ~~~~~~C~IC~~~~~~Pv~~~CgH~fc~~Ci~~~~~~~~---~~CP~C~~~~~~~~l~~n~~l~~   66 (78)
T 1t1h_A            5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGH---KTCPKSQETLLHAGLTPNYVLKS   66 (78)
T ss_dssp             CSSSSSCTTTSCCCSSEEEETTTEEEEHHHHHHHHTTTC---CBCTTTCCBCSSCCCEECTTTHH
T ss_pred             CcccCCCCCccccccCCEEcCCCCeecHHHHHHHHHHCc---CCCCCCcCCCChhhCccCHHHHH
Confidence            567899999999999999999999999999999997633   78999999998888887776644



>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 7e-13
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-12
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 5e-10
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-08
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-08
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 6e-08
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 8e-07
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 1e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 3e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 7e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.002
d1zbdb_124 g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat 0.004
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 0.004
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.9 bits (147), Expect = 7e-13
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 69  VKWEYIQQIRGFGNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPIC 128
           ++ E +Q +     + ++CPICL+L + P  T+C H FC  C+L  L        +CP+C
Sbjct: 6   LRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPS-QCPLC 64

Query: 129 YEAVHLGDLK 138
              +    L+
Sbjct: 65  KNDITKRSLQ 74


>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.57
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.56
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.56
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.55
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.51
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.48
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.39
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.36
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.36
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.29
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.28
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.27
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.07
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.96
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.91
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.39
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 93.99
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 82.86
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.57  E-value=8.6e-16  Score=107.63  Aligned_cols=63  Identities=16%  Similarity=0.098  Sum_probs=56.5

Q ss_pred             CCCCccccccCCCCCCcEEcCCCccccHHHHHHHHHhCCCCCCCCCCCCccccCCCCcchhHHHHh
Q psy3978          81 GNEDIKCPICLDLPRAPQMTRCGHCFCWPCILHYLALSDKSWRKCPICYEAVHLGDLKSFRSVIKR  146 (243)
Q Consensus        81 ~~~~~~CpICl~~~~~p~~~~CgH~FC~~Ci~~~~~~~~~~~~~CP~Cr~~~~~~~l~~~~~~~~~  146 (243)
                      ..+++.||||+++|.+|++++|||+||..||.+|+....   ..||.|+..+...++.++..+...
T Consensus         4 iP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~---~~cP~c~~~l~~~~l~pN~~L~~~   66 (80)
T d2c2la2           4 IPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVG---HFNPVTRSPLTQEQLIPNLAMKEV   66 (80)
T ss_dssp             CCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTC---SSCTTTCCCCCGGGCEECHHHHHH
T ss_pred             CCccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCC---ccCCCccccccccccccHHHHHHH
Confidence            568999999999999999999999999999999998754   689999999998888888877544



>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure