Diaphorina citri psyllid: psy3982


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MRTRYVPEGNLTACGTDYLTKDWHHRSYLIFYGFFVYFVPLILIIYAYYFIVRAVSVHEKQMREQAKKMNVATLRSGDQSGTSAEIKLAKVALMTISLWFLAWTPYLVINFGGILEMVEINPLITIWGSVFAKANAVYNPIVYAISHPKFRQALDKKFPSLVCGTVESDSSSAASVQTNVTDDKA
cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHEEccHHHHHHHHHHccccccccccccccccccccCECccccc
*RTRYVPEGNLTACGTDYLTKDWHHRSYLIFYGFFVYFVPLILIIYAYYFIVRAVSVHEK************************EIKLAKVALMTISLWFLAWTPYLVINFGGILEMVEINPLITIWGSVFAKANAVYNPIVYAISHPKFRQALDKKFPSLVCG*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTRYVPEGNLTACGTDYLTKDWHHRSYLIFYGFFVYFVPLILIIYAYYFIVRAVSVHEKQMREQAKKMNVATLRSGDQSGTSAEIKLAKVALMTISLWFLAWTPYLVINFGGILEMVEINPLITIWGSVFAKANAVYNPIVYAISHPKFRQALDKKFPSLVCGTVESDSSSAASVQTNVTDDKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Opsin Rh1 Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.confidentP06002
Opsin Rh1 Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.confidentP28678

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0007602 [BP]phototransductionprobableGO:0044700, GO:0051716, GO:0009583, GO:0051606, GO:0009605, GO:0009581, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0009582, GO:0050794, GO:0008150, GO:0065007, GO:0009416, GO:0007165, GO:0023052, GO:0007154, GO:0009628, GO:0050789, GO:0044699
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005767 [CC]secondary lysosomeprobableGO:0005737, GO:0005575, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005764, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005771 [CC]multivesicular bodyprobableGO:0005737, GO:0043231, GO:0043227, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0016029 [CC]subrhabdomeral cisternaprobableGO:0005737, GO:0005575, GO:0031984, GO:0005783, GO:0044444, GO:0044463, GO:0044464, GO:0097425, GO:0005623, GO:0043231, GO:0044446, GO:0044432, GO:0043229, GO:0016028, GO:0005622, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422, GO:0005790
GO:0009584 [BP]detection of visible lightprobableGO:0009581, GO:0009582, GO:0009583, GO:0051606, GO:0009605, GO:0009628, GO:0009314, GO:0050896, GO:0009416, GO:0008150
GO:0005791 [CC]rough endoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z73, chain A
Confidence level:very confident
Coverage over the Query: 3-160
View the alignment between query and template
View the model in PyMOL
Template: 1JFP, chain A
Confidence level:probable
Coverage over the Query: 3-66,80-185
View the alignment between query and template
View the model in PyMOL