Diaphorina citri psyllid: psy3988

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---

MECNLFNNTCTPSYDMNVSRENETYQYCGEHFQSFQMSYDHYHGYISLFVCIFGIVANTLNIIVLTRKEMRSPTNSILTGLAIADLLVMLDYIPFTLHLNIMNKSKRDKFNYNWTMFVLFHSNFSQVCHTISIYLTVVLAIWRYIAVVYPQHNRQWCTMKTTTVTILVGYIVCPLLCLPIYVTSKLKSRIVLLNQLDNNAVNYSVHPGGNQSDHNVTLYDETNSYNATLYFIDLVDYNLTNEIKLSITLSILAGTKVTTMSPYMTRPTRTTPPCILSTSSTTI

cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEccccccccEEEEEcccccccccCEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc

***NLFNNTCTPSYDMNVSRENETYQYCGEHFQSFQMSYDHYHGYISLFVCIFGIVANTLNIIVLTRKEMRSPTNSILTGLAIADLLVMLDYIPFTLHLNIMNKSKRDKFNYNWTMFVLFHSNFSQVCHTISIYLTVVLAIWRYIAVVYPQHNRQWCTMKTTTVTILVGYIVCPLLCLPIYVTSKLKSRIVLLNQLDNNAVNYSVHPGGNQSDHNVTLYDETNSYNATLYFIDLVDYNLTNEIKLSITLSILAGTKVTTMSPY*************STS****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0007218 [BP]	neuropeptide signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0097458 [CC]	neuron part	probable	GO:0005575, GO:0044464, GO:0005623
GO:0008188 [MF]	neuropeptide receptor activity	probable	GO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003008 [BP]	system process	probable	GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SN6, chain R
Confidence level:very confident
Coverage over the Query: 38-182
View the alignment between query and template
View the model in PyMOL

Template: 4AMJ, chain A
Confidence level:very confident
Coverage over the Query: 36-212,235-265
View the alignment between query and template
View the model in PyMOL