Diaphorina citri psyllid: psy3995


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MAEVGTNVAAFLGKLWRMVEDPETNDLISWSENGQSFLIRNQSKFAKELLPRYYKHNNMASFIRQLN
cccccccccHHHHHHHHHHcccccccCEEEccccccEEEEcHHHHHHHHHHcccccccccHHHHHcc
*****TNVAAFLGKLWRMVEDPETNDLISWSENGQSFLIRNQSKFAKELLPRYYKHNNMASFIRQLN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEVGTNVAAFLGKLWRMVEDPETNDLISWSENGQSFLIRNQSKFAKELLPRYYKHNNMASFIRQLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock factor protein DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked.confidentP22813
Heat shock factor protein DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. Also required for growth at normal temperatures.confidentQ02953
Heat stress transcription factor B-2c Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).confidentQ652B0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0070207 [BP]protein homotrimerizationprobableGO:0051259, GO:0022607, GO:0070206, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0031490 [MF]chromatin DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003682, GO:1901363
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043010 [BP]camera-type eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0001162 [MF]RNA polymerase II intronic transcription regulatory region sequence-specific DNA bindingprobableGO:0044213, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001161, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0010243 [BP]response to organic nitrogenprobableGO:0009719, GO:0050896, GO:1901698, GO:0008150, GO:0042221, GO:0010033
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0045120 [CC]pronucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007283 [BP]spermatogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0033169 [BP]histone H3-K9 demethylationprobableGO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016577, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0070076, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HKS, chain A
Confidence level:very confident
Coverage over the Query: 5-67
View the alignment between query and template
View the model in PyMOL