Diaphorina citri psyllid: psy4003


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----
MRTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSAKDSSTGKAERITIQNDKGRLSKDDIDRMLAEAEKYKAEDDKQRERVAAKNKLESYAFAVKQAAEDSGSKLSDADKTSVSQACSATLTWLEGNSLAEKEEFEDRLKTLQQ
cccccEEEEECcccEEEEEEcccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHcccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHccccccccccccccHHHcccHHEEEEcccccccccccEEEEEcccccEEEEEccccEEEEccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEccEEEECcccccccccccccccccccccccEEEEEEEcccccccccccccccEEEECccccccccccEEEEEEcccccCEEEEEEcccccccEEEEECcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcc
**TNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSA************IQNDKGRLSKDDIDRMLAEAEKYKAEDD**RERVAAKNKLESYAFAV******************VSQACSATLTWLEGNSLAEKEEFEDRLK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSAKDSSTGKAERITIQNDKGRLSKDDxxxxxxxxxxxxxxxxxxxxxVAAKNKLESYAFAVKQAAEDSGSKLSDADKTSVSQACSATLTWLEGNSLAEKEEFEDRLKTLQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock 70 kDa protein confidentP08106
Heat shock 70 kDa protein 6 In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.confidentP17066
Probable heat shock protein ssa1 confidentQ10265

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043227 [CC]membrane-bounded organelleprobableGO:0005575, GO:0043226
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YUW, chain A
Confidence level:very confident
Coverage over the Query: 2-128,196-297,368-489
View the alignment between query and template
View the model in PyMOL
Template: 2KHO, chain A
Confidence level:very confident
Coverage over the Query: 2-128,196-297,368-535
View the alignment between query and template
View the model in PyMOL
Template: 1NGD, chain A
Confidence level:very confident
Coverage over the Query: 4-150
View the alignment between query and template
View the model in PyMOL
Template: 2V7Z, chain A
Confidence level:very confident
Coverage over the Query: 6-150
View the alignment between query and template
View the model in PyMOL
Template: 1DKX, chain A
Confidence level:confident
Coverage over the Query: 337-535
View the alignment between query and template
View the model in PyMOL