Psyllid ID: psy4003

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----

MRTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSAKDSSTGKAERITIQNDKGRLSKDDIDRMLAEAEKYKAEDDKQRERVAAKNKLESYAFAVKQAAEDSGSKLSDADKTSVSQACSATLTWLEGNSLAEKEEFEDRLKTLQQ

cccccEEEEEEcccEEEEEEcccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHcccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHccccccccccccccHHHcccHHEEEEcccccccccccEEEEEcccccEEEEEccccEEEEccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEEcccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEccccccccccEEEEEEcccccEEEEEEEcccccccEEEEEEcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcc

cccEEEEEEEcEccEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHccEEEEEcHHHHcHHHHHHHHHHHHcccEEEEEEEHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHccEEEEEcHHHHcHHHHHHHHHHccccccEcccccccHHHHHHHHHHHHccccccHHHHHcccccEccccEEEEEcccEEEEEEccccEccEEEEEEEEEcccccccEEEEEEEccccccccccccccEcccHcHcccccccEEEEEEEcccccccccccccccccEEEEEEEEccEEEEEEEEccccEHHHcEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHc

mrtngsvlaidegslfqvkstagdthlggedfdnRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNdakldkgsihdVVLVggsiripkiqkmlqipplifrDFYSKITRARFEELCMDLFRQTLAPVERALNdakldkgsihdVVLVGGSIRIPKIQKMLQDFfngkslnlsinpdEAVAYGAAVQAAILSGDTSSAIQDVLLVDvaplslgietaGGVMTKIVErnsripckqqqtfteqpsklpssvetpvlpskmscwpdaiggqlrftpecchyselsIMYVGNIttwrtnshfnpiplfqpksfshsryqnAVTIQVFEgeramtkdnnllgtfnltgippaprgvpkievtfdldangilnvsakdsstgkaeritiqndkgrlskDDIDRMLAEAEKYKAEDDKQRERVAAKNKLESYAFAVKQAAedsgsklsdadktsVSQACSATLtwlegnslaeKEEFEDRLKTLQQ

mrtngsvlaidegslFQVKSTAgdthlggedfDNRLVTFFADefkrkhkkdilantravrRLRTACErakrtlsssteasleidalhEGIDFYSKITRARFEELCMDLFRQTLAPVERALndakldkgsihDVVLVggsiripkiqkmlqipplIFRDFYSKITRARFEELCMDLFRQTLAPVERALndakldkgsihdVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNsripckqqqtfteqpsklpssVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFqpksfshsrYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNvsakdsstgkaeritiqndkgrlskddIDRMLAEAekykaeddkqrERVAAKNKLESYAFAVKQAAedsgsklsdadkTSVSQACSATltwlegnslaekeeFEDRLKTLQQ

MRTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEavaygaavqaaILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSAKDSSTGKAERITIQNDKGRLSKDDIDRMLAEAEKYKAEDDKQRERVAAKNKLESYAFAVKQAAEDSGSKLSDADKTSVSQACSATLTWLEGNSLAEKEEFEDRLKTLQQ

************GSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACE*************LEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVER*******************************MSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNV**************************************************************************************TLTWL********************

**TNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKR****************RTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLA*************GSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKI****FEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTP**C*YSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPP****VPKIEVTFDLDANGILNVSA************IQNDKGRLSKDDIDRMLAEAEKYKAEDD**RERVAAKNKLESYAFAV******************VSQACSATLTWLEGNSLAEKEEFEDRLKTL**

MRTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTAC************ASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQ******************VLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSA*********RITIQNDKGRLSKDDIDRMLAEAEK************AAKNKLESYAFAVK********************ACSATLTWLEGNSLA**************

*RTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSAKDSSTGKAERITIQNDKGRLSKDDIDRMLAEAEKYKAEDDKQRERVAAKNKLESYAFAVKQAAEDSGSKLSDADKTSVSQACSATLTWLEGNSLAEKEEFEDRLK****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAIGGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIPPAPRGVPKIEVTFDLDANGILNVSAKDSSTGKAERITIQNDKGRLSKDDxxxxxxxxxxxxxxxxxxxxxVAAKNKLESYAFAVKQAAEDSGSKLSDADKTSVSQACSATLTWLEGNSLAEKEEFEDRLKTLQQ

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		535	2.2.26 [Sep-21-2011]
Q9S9N1		646	Heat shock 70 kDa protein	yes	N/A	0.429	0.356	0.533	3e-81
P11146		633	Heat shock 70 kDa protein	yes	N/A	0.416	0.352	0.572	5e-81
P27322		644	Heat shock cognate 70 kDa	N/A	N/A	0.429	0.357	0.523	1e-78
Q9LHA8		650	Probable mediator of RNA	no	N/A	0.429	0.353	0.523	5e-78
P09189		651	Heat shock cognate 70 kDa	N/A	N/A	0.429	0.353	0.523	5e-78
P22953		651	Probable mediator of RNA	no	N/A	0.429	0.353	0.516	9e-78
Q10265		644	Probable heat shock prote	yes	N/A	0.730	0.607	0.369	6e-77
P26413		645	Heat shock 70 kDa protein	no	N/A	0.429	0.356	0.510	3e-76
Q9C7X7		617	Heat shock 70 kDa protein	no	N/A	0.428	0.371	0.508	2e-75
P22954		653	Probable mediator of RNA	no	N/A	0.429	0.352	0.5	2e-75

>sp\|Q9S9N1\|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1	Back alignment and function desciption

 Score =  303 bits (775), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 159/298 (53%), Positives = 197/298 (66%), Gaps = 68/298 (22%)

Query: 6   SVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTA 65
           S+L I+EG +F+VK+TAGDTHLGGEDFDNRLV  F  EF+RKHKKDI  N RA+RRLRTA
Sbjct: 213 SLLTIEEG-VFEVKATAGDTHLGGEDFDNRLVNHFVAEFRRKHKKDIAGNARALRRLRTA 271

Query: 66  CERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKL 125
           CERAKRTLSS+ + ++EID+LHEGIDFY+ I+RARFEE+ MDLFR+ + PVE+ L DAKL
Sbjct: 272 CERAKRTLSSTAQTTIEIDSLHEGIDFYATISRARFEEMNMDLFRKCMDPVEKVLKDAKL 331

Query: 126 DKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVER 185
           DK S+HDVVLVGGS RIPKIQ++LQ       DF++       +ELC             
Sbjct: 332 DKSSVHDVVLVGGSTRIPKIQQLLQ-------DFFNG------KELC------------- 365

Query: 186 ALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAI 245
                                                KS+N    PDEAVAYGAAVQAAI
Sbjct: 366 -------------------------------------KSIN----PDEAVAYGAAVQAAI 384

Query: 246 LSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPS 303
           L+G+ S  +QD+LL+DVAPLSLG+ETAGGVMT ++ RN+ +PCK++Q F+      P 
Sbjct: 385 LTGEGSEKVQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTVPCKKEQVFSTYADNQPG 442

In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
Arabidopsis thaliana (taxid: 3702)

>sp\|P11146\|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2	Back alignment and function description

>sp\|P27322\|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1	Back alignment and function description

>sp\|Q9LHA8\|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1	Back alignment and function description

>sp\|P09189\|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1	Back alignment and function description

>sp\|P22953\|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3	Back alignment and function description

>sp\|Q10265\|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2	Back alignment and function description

>sp\|P26413\|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1	Back alignment and function description

>sp\|Q9C7X7\|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=1 SV=1	Back alignment and function description

>sp\|P22954\|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		535
193587299		623	PREDICTED: heat shock protein 70 B2-like	0.416	0.357	0.672	1e-98
6465982		650	heat shock protein 70 [Stylophora pistil	0.577	0.475	0.544	8e-98
431144		649	HSP70 [Lilium longiflorum]	0.730	0.602	0.412	1e-93
307210424		578	Heat shock 70 kDa protein cognate 4 [Har	0.732	0.678	0.417	3e-91
346652550		643	hsp70 protein [Cyprinus carpio]	0.736	0.612	0.415	6e-89
195108677		636	GI23362 [Drosophila mojavensis] gi\|19391	0.732	0.616	0.422	7e-89
195395136		635	GJ10355 [Drosophila virilis] gi\|19414290	0.734	0.618	0.419	1e-88
32394423		626	heat shock protein Hsp70 [Cyprinus carpi	0.736	0.629	0.415	1e-88
195446397		635	GK12230 [Drosophila willistoni] gi\|19416	0.734	0.618	0.412	3e-88
146231276		622	heat shock protein 70kDa [Physocyclus sp	0.429	0.369	0.616	1e-87

>gi\|193587299\|ref\|XP_001949837.1\| PREDICTED: heat shock protein 70 B2-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  367 bits (941), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 208/290 (71%), Gaps = 67/290 (23%)

Query: 6   SVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTA 65
           S+LAIDEGSLF+VKSTAGDTHLGGEDFDNRLVT F +EFKRK KKDI  NTRA+RRLRTA
Sbjct: 208 SILAIDEGSLFEVKSTAGDTHLGGEDFDNRLVTHFVEEFKRKCKKDISGNTRALRRLRTA 267

Query: 66  CERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKL 125
           CERAKRTLSSST                                            +A L
Sbjct: 268 CERAKRTLSSST--------------------------------------------EASL 283

Query: 126 DKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYSKITRARFEELCMDLFRQTLAPVER 185
           +  ++HD V                       DFYSKITRARFEE+CMDLFR TL+PVE+
Sbjct: 284 EIDALHDGV-----------------------DFYSKITRARFEEMCMDLFRSTLSPVEK 320

Query: 186 ALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAVQAAI 245
           AL DAK+DK SIHDVVLVGGS RIPKIQKMLQDFF GKSLNLSINPDEAVAYGAAVQAAI
Sbjct: 321 ALADAKMDKSSIHDVVLVGGSTRIPKIQKMLQDFFCGKSLNLSINPDEAVAYGAAVQAAI 380

Query: 246 LSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFT 295
           LSGDTSSAIQDVLLVDV PLSLGIETAGGVMTK+VERNSRIPCKQQQTFT
Sbjct: 381 LSGDTSSAIQDVLLVDVTPLSLGIETAGGVMTKLVERNSRIPCKQQQTFT 430

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|6465982\|gb\|AAF12746.1\|AF152004_1 heat shock protein 70 [Stylophora pistillata]	Back alignment and taxonomy information

>gi\|431144\|dbj\|BAA04848.1\| HSP70 [Lilium longiflorum]	Back alignment and taxonomy information

>gi\|307210424\|gb\|EFN86984.1\| Heat shock 70 kDa protein cognate 4 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|346652550\|gb\|AEO44578.1\| hsp70 protein [Cyprinus carpio]	Back alignment and taxonomy information

>gi\|195108677\|ref\|XP_001998919.1\| GI23362 [Drosophila mojavensis] gi\|193915513\|gb\|EDW14380.1\| GI23362 [Drosophila mojavensis]	Back alignment and taxonomy information

>gi\|195395136\|ref\|XP_002056192.1\| GJ10355 [Drosophila virilis] gi\|194142901\|gb\|EDW59304.1\| GJ10355 [Drosophila virilis]	Back alignment and taxonomy information

>gi\|32394423\|gb\|AAM81603.1\| heat shock protein Hsp70 [Cyprinus carpio]	Back alignment and taxonomy information

>gi\|195446397\|ref\|XP_002070761.1\| GK12230 [Drosophila willistoni] gi\|194166846\|gb\|EDW81747.1\| GK12230 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|146231276\|gb\|ABQ12809.1\| heat shock protein 70kDa [Physocyclus sp. G597]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		535
FB\|FBgn0001217		633	Hsc70-2 "Heat shock protein co	0.271	0.229	0.848	7.2e-124
FB\|FBgn0001230		635	Hsp68 "Heat shock protein 68"	0.370	0.311	0.6	1.1e-120
UNIPROTKB\|E7EP94		550	HSPA1A "Heat shock 70 kDa prot	0.334	0.325	0.653	2.9e-118
UNIPROTKB\|F8VZJ4		618	HSPA1B "Heat shock 70 kDa prot	0.334	0.289	0.653	2.9e-118
UNIPROTKB\|P08107		641	HSPA1A "Heat shock 70 kDa prot	0.334	0.279	0.653	2.9e-118
UNIPROTKB\|Q27965		641	HSPA1B "Heat shock 70 kDa prot	0.334	0.279	0.648	5.9e-118
UNIPROTKB\|Q27975		641	HSPA1A "Heat shock 70 kDa prot	0.334	0.279	0.648	5.9e-118
UNIPROTKB\|I3L7U0		599	HSPA2 "Uncharacterized protein	0.334	0.298	0.648	7.6e-118
UNIPROTKB\|Q6S4N2		641	HSPA1B "Heat shock 70 kDa prot	0.334	0.279	0.648	7.6e-118
UNIPROTKB\|G1K268		646	HSP70 "Uncharacterized protein	0.269	0.222	0.793	1.2e-117

FB\|FBgn0001217 Hsc70-2 "Heat shock protein cognate 2" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 624 (224.7 bits), Expect = 7.2e-124, Sum P(2) = 7.2e-124
 Identities = 123/145 (84%), Positives = 134/145 (92%)

Query:     6 SVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTA 65
             SVL+IDEGSLF+VK+TAGDTHLGGEDFDNRLV  FA+EFKRKHK DI  N RA+RRLRTA
Sbjct:   208 SVLSIDEGSLFEVKATAGDTHLGGEDFDNRLVNHFAEEFKRKHKSDIKGNARALRRLRTA 267

Query:    66 CERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKL 125
             CERAKRTLSSSTEASLEIDALHEGIDFYSKI+RARFEEL MDLFR T+ PVERAL+DAK+
Sbjct:   268 CERAKRTLSSSTEASLEIDALHEGIDFYSKISRARFEELNMDLFRSTMQPVERALSDAKM 327

Query:   126 DKGSIHDVVLVGGSIRIPKIQKMLQ 150
             DK +IHDVVLVGGS RIPKIQK+LQ
Sbjct:   328 DKKAIHDVVLVGGSTRIPKIQKLLQ 352

GO:0006457 "protein folding" evidence=ISS

GO:0009408 "response to heat" evidence=NAS

GO:0005739 "mitochondrion" evidence=ISS

GO:0051082 "unfolded protein binding" evidence=ISS

FB\|FBgn0001230 Hsp68 "Heat shock protein 68" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|E7EP94 HSPA1A "Heat shock 70 kDa protein 1A/1B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F8VZJ4 HSPA1B "Heat shock 70 kDa protein 1A/1B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|P08107 HSPA1A "Heat shock 70 kDa protein 1A/1B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q27965 HSPA1B "Heat shock 70 kDa protein 1B" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q27975 HSPA1A "Heat shock 70 kDa protein 1A" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|I3L7U0 HSPA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6S4N2 HSPA1B "Heat shock 70 kDa protein 1B" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|G1K268 HSP70 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P08106	HSP70_CHICK	No assigned EC number	0.5172	0.4149	0.3501	yes	N/A
Q54BE0	HS7C3_DICDI	No assigned EC number	0.5034	0.4149	0.3523	yes	N/A
Q9S9N1	HSP7E_ARATH	No assigned EC number	0.5335	0.4299	0.3560	yes	N/A
Q10265	HSP71_SCHPO	No assigned EC number	0.3691	0.7308	0.6071	yes	N/A
P17066	HSP76_HUMAN	No assigned EC number	0.5100	0.4299	0.3576	yes	N/A
P11146	HSP7B_DROME	No assigned EC number	0.5724	0.4168	0.3522	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		535
cd10233		376	cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding	2e-92
PTZ00009		653	PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro	1e-78
PTZ00009		653	PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro	7e-73
PTZ00009		653	PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro	1e-72
cd10241		374	cd10241, HSPA5-like_NBD, Nucleotide-binding domain	1e-64
pfam00012		598	pfam00012, HSP70, Hsp70 protein	2e-64
pfam00012		598	pfam00012, HSP70, Hsp70 protein	2e-63
PRK00290		627	PRK00290, dnaK, molecular chaperone DnaK; Provisio	6e-63
pfam00012		598	pfam00012, HSP70, Hsp70 protein	6e-62
PRK00290		627	PRK00290, dnaK, molecular chaperone DnaK; Provisio	8e-61
cd10233		376	cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding	5e-56
TIGR02350		595	TIGR02350, prok_dnaK, chaperone protein DnaK	1e-54
TIGR02350		595	TIGR02350, prok_dnaK, chaperone protein DnaK	4e-54
cd10170		369	cd10170, HSP70_NBD, Nucleotide-binding domain of t	6e-54
PLN03184		673	PLN03184, PLN03184, chloroplast Hsp70; Provisional	5e-51
CHL00094		621	CHL00094, dnaK, heat shock protein 70	5e-47
COG0443		579	COG0443, DnaK, Molecular chaperone [Posttranslatio	5e-47
PRK13411		653	PRK13411, PRK13411, molecular chaperone DnaK; Prov	2e-46
PTZ00400		663	PTZ00400, PTZ00400, DnaK-type molecular chaperone;	1e-45
PRK13410		668	PRK13410, PRK13410, molecular chaperone DnaK; Prov	1e-45
PRK00290		627	PRK00290, dnaK, molecular chaperone DnaK; Provisio	2e-45
COG0443		579	COG0443, DnaK, Molecular chaperone [Posttranslatio	2e-45
cd10234		376	cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d	6e-45
COG0443		579	COG0443, DnaK, Molecular chaperone [Posttranslatio	7e-44
CHL00094		621	CHL00094, dnaK, heat shock protein 70	2e-43
PRK13411		653	PRK13411, PRK13411, molecular chaperone DnaK; Prov	4e-43
cd10228		381	cd10228, HSPA4_like_NDB, Nucleotide-binding domain	1e-42
PRK05183		616	PRK05183, hscA, chaperone protein HscA; Provisiona	3e-42
cd10241		374	cd10241, HSPA5-like_NBD, Nucleotide-binding domain	9e-42
cd10238		375	cd10238, HSPA14-like_NBD, Nucleotide-binding domai	1e-40
TIGR01991		599	TIGR01991, HscA, Fe-S protein assembly chaperone H	2e-40
TIGR02350		595	TIGR02350, prok_dnaK, chaperone protein DnaK	3e-40
cd11733		377	cd11733, HSPA9-like_NBD, Nucleotide-binding domain	2e-39
PTZ00400		663	PTZ00400, PTZ00400, DnaK-type molecular chaperone;	2e-38
cd10230		388	cd10230, HYOU1-like_NBD, Nucleotide-binding domain	2e-38
CHL00094		621	CHL00094, dnaK, heat shock protein 70	3e-37
PRK13410		668	PRK13410, PRK13410, molecular chaperone DnaK; Prov	5e-37
cd11734		373	cd11734, Ssq1_like_NBD, Nucleotide-binding domain	8e-37
cd10232		386	cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma	2e-36
PLN03184		673	PLN03184, PLN03184, chloroplast Hsp70; Provisional	3e-36
cd10234		376	cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d	2e-32
cd10235		339	cd10235, HscC_like_NBD, Nucleotide-binding domain	4e-32
PTZ00186		657	PTZ00186, PTZ00186, heat shock 70 kDa precursor pr	1e-31
PRK13411		653	PRK13411, PRK13411, molecular chaperone DnaK; Prov	1e-30
cd11732		377	cd11732, HSP105-110_like_NBD, Nucleotide-binding d	5e-30
cd10170		369	cd10170, HSP70_NBD, Nucleotide-binding domain of t	1e-29
PTZ00400		663	PTZ00400, PTZ00400, DnaK-type molecular chaperone;	1e-28
PTZ00186		657	PTZ00186, PTZ00186, heat shock 70 kDa precursor pr	2e-28
cd10236		355	cd10236, HscA_like_NBD, Nucleotide-binding domain	5e-28
cd10236		355	cd10236, HscA_like_NBD, Nucleotide-binding domain	2e-25
cd11737		383	cd11737, HSPA4_NBD, Nucleotide-binding domain of H	2e-25
cd10228		381	cd10228, HSPA4_like_NDB, Nucleotide-binding domain	4e-25
cd11733		377	cd11733, HSPA9-like_NBD, Nucleotide-binding domain	4e-25
cd10238		375	cd10238, HSPA14-like_NBD, Nucleotide-binding domai	6e-25
cd11739		383	cd11739, HSPH1_NBD, Nucleotide-binding domain of H	6e-25
cd10237		417	cd10237, HSPA13-like_NBD, Nucleotide-binding domai	1e-24
TIGR01991		599	TIGR01991, HscA, Fe-S protein assembly chaperone H	2e-24
cd11738		383	cd11738, HSPA4L_NBD, Nucleotide-binding domain of	4e-24
cd10230		388	cd10230, HYOU1-like_NBD, Nucleotide-binding domain	6e-24
cd10237		417	cd10237, HSPA13-like_NBD, Nucleotide-binding domai	6e-24
cd11734		373	cd11734, Ssq1_like_NBD, Nucleotide-binding domain	2e-23
cd10235		339	cd10235, HscC_like_NBD, Nucleotide-binding domain	5e-23
PTZ00186		657	PTZ00186, PTZ00186, heat shock 70 kDa precursor pr	3e-22
PRK05183		616	PRK05183, hscA, chaperone protein HscA; Provisiona	1e-21
PRK01433		595	PRK01433, hscA, chaperone protein HscA; Provisiona	5e-20
cd11732		377	cd11732, HSP105-110_like_NBD, Nucleotide-binding d	4e-17
cd11737		383	cd11737, HSPA4_NBD, Nucleotide-binding domain of H	2e-16
PRK01433		595	PRK01433, hscA, chaperone protein HscA; Provisiona	3e-16
cd11738		383	cd11738, HSPA4L_NBD, Nucleotide-binding domain of	1e-14
cd10232		386	cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma	2e-14
cd11739		383	cd11739, HSPH1_NBD, Nucleotide-binding domain of H	6e-14
PRK01433		595	PRK01433, hscA, chaperone protein HscA; Provisiona	7e-09
cd10231		415	cd10231, YegD_like, Escherichia coli YegD, a putat	4e-08
TIGR01312		481	TIGR01312, XylB, D-xylulose kinase	4e-04
cd07809		487	cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup	4e-04
cd10231		415	cd10231, YegD_like, Escherichia coli YegD, a putat	0.001

>gnl\|CDD\|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins	Back alignment and domain information

 Score =  286 bits (735), Expect = 2e-92
 Identities = 111/145 (76%), Positives = 126/145 (86%), Gaps = 1/145 (0%)

Query: 6   SVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTA 65
           S+L I++G +F+VK+TAGDTHLGGEDFDNRLV  F  EFKRKHKKDI  N RA+RRLRTA
Sbjct: 203 SLLTIEDG-IFEVKATAGDTHLGGEDFDNRLVNHFVQEFKRKHKKDISGNKRALRRLRTA 261

Query: 66  CERAKRTLSSSTEASLEIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKL 125
           CERAKRTLSSST+AS+EID+L EGIDFY+ ITRARFEELC DLFR TL PVE+ L DAKL
Sbjct: 262 CERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELCADLFRGTLEPVEKVLRDAKL 321

Query: 126 DKGSIHDVVLVGGSIRIPKIQKMLQ 150
           DK  IHD+VLVGGS RIPK+QK+LQ
Sbjct: 322 DKSQIHDIVLVGGSTRIPKVQKLLQ 346

This subfamily includes human HSPA1A (70-kDa heat shock protein 1A, also known as HSP72; HSPA1; HSP70I; HSPA1B; HSP70-1; HSP70-1A), HSPA1B (70-kDa heat shock protein 1B, also known as HSPA1A; HSP70-2; HSP70-1B), and HSPA1L (70-kDa heat shock protein 1-like, also known as HSP70T; hum70t; HSP70-1L; HSP70-HOM). The genes for these three HSPA1 proteins map in close proximity on the major histocompatibility complex (MHC) class III region on chromosome 6, 6p21.3. This subfamily also includes human HSPA8 (heat shock 70kDa protein 8, also known as LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; NIP71; HSPA10; the HSPA8 gene maps to 11q24.1), human HSPA2 (70-kDa heat shock protein 2, also known as HSP70-2; HSP70-3, the HSPA2 gene maps to 14q24.1), human HSPA6 (also known as heat shock 70kDa protein 6 (HSP70B') gi 94717614, the HSPA6 gene maps to 1q23.3), human HSPA7 (heat shock 70kDa protein 7 , also known as HSP70B; the HSPA7 gene maps to 1q23.3) and Saccharmoyces cerevisiae Stress-Seventy subfamily B/Ssb1p. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Associations of polymorphisms within the MHC-III HSP70 gene locus with longevity, systemic lupus erythematosus, Meniere's disease, noise-induced hearing loss, high-altitude pulmonary edema, and coronary heart disease, have been found. HSPA2 is involved in cancer cell survival, is required for maturation of male gametophytes, and is linked to male infertility. The induction of HSPA6 is a biomarker of cellular stress. HSPA8 participates in the folding and trafficking of client proteins to different subcellular compartments, and in the signal transduction and apoptosis process; it has been shown to protect cardiomyocytes against oxidative stress partly through an interaction with alpha-enolase. S. cerevisiae Ssb1p, is part of the ribosome-associated complex (RAC), it acts as a chaperone for nascent polypeptides, and is important for translation fidelity; Ssb1p is also a [PSI+] prion-curing factor. Length = 376

>gnl\|CDD\|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional	Back alignment and domain information

>gnl\|CDD\|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins	Back alignment and domain information

>gnl\|CDD\|215656 pfam00012, HSP70, Hsp70 protein	Back alignment and domain information

>gnl\|CDD\|215656 pfam00012, HSP70, Hsp70 protein	Back alignment and domain information

>gnl\|CDD\|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|215656 pfam00012, HSP70, Hsp70 protein	Back alignment and domain information

>gnl\|CDD\|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins	Back alignment and domain information

>gnl\|CDD\|233830 TIGR02350, prok_dnaK, chaperone protein DnaK	Back alignment and domain information

>gnl\|CDD\|233830 TIGR02350, prok_dnaK, chaperone protein DnaK	Back alignment and domain information

>gnl\|CDD\|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family	Back alignment and domain information

>gnl\|CDD\|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional	Back alignment and domain information

>gnl\|CDD\|214360 CHL00094, dnaK, heat shock protein 70	Back alignment and domain information

>gnl\|CDD\|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins	Back alignment and domain information

>gnl\|CDD\|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|214360 CHL00094, dnaK, heat shock protein 70	Back alignment and domain information

>gnl\|CDD\|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins	Back alignment and domain information

>gnl\|CDD\|235360 PRK05183, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins	Back alignment and domain information

>gnl\|CDD\|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA	Back alignment and domain information

>gnl\|CDD\|233830 TIGR02350, prok_dnaK, chaperone protein DnaK	Back alignment and domain information

>gnl\|CDD\|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins	Back alignment and domain information

>gnl\|CDD\|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|214360 CHL00094, dnaK, heat shock protein 70	Back alignment and domain information

>gnl\|CDD\|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins	Back alignment and domain information

>gnl\|CDD\|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional	Back alignment and domain information

>gnl\|CDD\|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins	Back alignment and domain information

>gnl\|CDD\|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>gnl\|CDD\|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional	Back alignment and domain information

>gnl\|CDD\|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins	Back alignment and domain information

>gnl\|CDD\|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family	Back alignment and domain information

>gnl\|CDD\|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>gnl\|CDD\|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>gnl\|CDD\|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins	Back alignment and domain information

>gnl\|CDD\|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins	Back alignment and domain information

>gnl\|CDD\|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4	Back alignment and domain information

>gnl\|CDD\|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins	Back alignment and domain information

>gnl\|CDD\|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1	Back alignment and domain information

>gnl\|CDD\|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins	Back alignment and domain information

>gnl\|CDD\|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA	Back alignment and domain information

>gnl\|CDD\|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L	Back alignment and domain information

>gnl\|CDD\|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins	Back alignment and domain information

>gnl\|CDD\|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235360 PRK05183, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|234955 PRK01433, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins	Back alignment and domain information

>gnl\|CDD\|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4	Back alignment and domain information

>gnl\|CDD\|234955 PRK01433, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L	Back alignment and domain information

>gnl\|CDD\|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins	Back alignment and domain information

>gnl\|CDD\|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1	Back alignment and domain information

>gnl\|CDD\|234955 PRK01433, hscA, chaperone protein HscA; Provisional	Back alignment and domain information

>gnl\|CDD\|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins	Back alignment and domain information

>gnl\|CDD\|233354 TIGR01312, XylB, D-xylulose kinase	Back alignment and domain information

>gnl\|CDD\|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases	Back alignment and domain information

>gnl\|CDD\|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		535
KOG0100\|consensus		663		100.0
PTZ00009		653	heat shock 70 kDa protein; Provisional	100.0
KOG0101\|consensus		620		100.0
PRK13411		653	molecular chaperone DnaK; Provisional	100.0
PTZ00186		657	heat shock 70 kDa precursor protein; Provisional	100.0
PRK13410		668	molecular chaperone DnaK; Provisional	100.0
PLN03184		673	chloroplast Hsp70; Provisional	100.0
PTZ00400		663	DnaK-type molecular chaperone; Provisional	100.0
PRK00290		627	dnaK molecular chaperone DnaK; Provisional	100.0
TIGR02350		595	prok_dnaK chaperone protein DnaK. Members of this	100.0
CHL00094		621	dnaK heat shock protein 70	100.0
TIGR01991		599	HscA Fe-S protein assembly chaperone HscA. The Hea	100.0
PRK05183		616	hscA chaperone protein HscA; Provisional	100.0
KOG0102\|consensus		640		100.0
PRK01433		595	hscA chaperone protein HscA; Provisional	100.0
PF00012		602	HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho	100.0
COG0443		579	DnaK Molecular chaperone [Posttranslational modifi	100.0
KOG0103\|consensus		727		100.0
KOG0104\|consensus		902		100.0
PRK11678		450	putative chaperone; Provisional	99.9
PRK13928		336	rod shape-determining protein Mbl; Provisional	99.74
PRK13927		334	rod shape-determining protein MreB; Provisional	99.66
PRK13929		335	rod-share determining protein MreBH; Provisional	99.61
TIGR00904		333	mreB cell shape determining protein, MreB/Mrl fami	99.6
PRK13930		335	rod shape-determining protein MreB; Provisional	99.58
PF06723		326	MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba	99.35
TIGR02529		239	EutJ ethanolamine utilization protein EutJ family	99.28
PRK15080		267	ethanolamine utilization protein EutJ; Provisional	99.28
TIGR01174		371	ftsA cell division protein FtsA. This bacterial ce	99.19
PRK09472		420	ftsA cell division protein FtsA; Reviewed	98.96
COG1077		342	MreB Actin-like ATPase involved in cell morphogene	98.9
COG0849		418	ftsA Cell division ATPase FtsA [Cell division and	97.9
PRK13917		344	plasmid segregation protein ParM; Provisional	97.41
PF11104		340	PilM_2: Type IV pilus assembly protein PilM;; PDB:	96.72
TIGR00241		248	CoA_E_activ CoA-substrate-specific enzyme activase	96.58
cd00012		371	ACTIN Actin; An ubiquitous protein involved in the	96.49
KOG0100\|consensus		663		96.36
PF02782		198	FGGY_C: FGGY family of carbohydrate kinases, C-ter	96.21
TIGR03192		293	benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s	96.13
smart00268		373	ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki	95.8
TIGR02261		262	benz_CoA_red_D benzoyl-CoA reductase, bcr type, su	95.72
PRK15027		484	xylulokinase; Provisional	95.56
TIGR01175		348	pilM type IV pilus assembly protein PilM. This pro	95.53
TIGR02259		432	benz_CoA_red_A benzoyl-CoA reductase, bcr type, su	95.12
TIGR03286		404	methan_mark_15 putative methanogenesis marker prot	95.11
COG0443		579	DnaK Molecular chaperone [Posttranslational modifi	95.03
TIGR03739		320	PRTRC_D PRTRC system protein D. A novel genetic sy	94.86
PLN02669		556	xylulokinase	94.78
TIGR01315		541	5C_CHO_kinase FGGY-family pentulose kinase. This m	94.67
PF00022		393	Actin: Actin; InterPro: IPR004000 Actin [, ] is a	94.25
TIGR02628		465	fuculo_kin_coli L-fuculokinase. Members of this fa	94.22
TIGR01312		481	XylB D-xylulose kinase. D-xylulose kinase (XylB) g	94.2
TIGR01234		536	L-ribulokinase L-ribulokinase. This enzyme catalyz	94.1
PTZ00280		414	Actin-related protein 3; Provisional	94.08
PRK00047		498	glpK glycerol kinase; Provisional	94.04
PRK04123		548	ribulokinase; Provisional	94.01
COG1924		396	Activator of 2-hydroxyglutaryl-CoA dehydratase (HS	93.98
TIGR01311		493	glycerol_kin glycerol kinase. This model describes	93.91
PTZ00294		504	glycerol kinase-like protein; Provisional	93.89
PTZ00186		657	heat shock 70 kDa precursor protein; Provisional	93.49
TIGR01314		505	gntK_FGGY gluconate kinase, FGGY type. Gluconate i	93.47
PRK10331		470	L-fuculokinase; Provisional	93.42
PLN02295		512	glycerol kinase	93.3
PRK13317		277	pantothenate kinase; Provisional	93.08
TIGR02627		454	rhamnulo_kin rhamnulokinase. This model describes	92.93
PRK10640		471	rhaB rhamnulokinase; Provisional	92.62
KOG2531\|consensus		545		92.53
PRK10939		520	autoinducer-2 (AI-2) kinase; Provisional	92.18
PRK13410		668	molecular chaperone DnaK; Provisional	92.08
KOG0102\|consensus		640		92.04
KOG2517\|consensus		516		91.83
KOG0101\|consensus		620		91.63
PLN03184		673	chloroplast Hsp70; Provisional	91.14
CHL00094		621	dnaK heat shock protein 70	90.75
TIGR02350		595	prok_dnaK chaperone protein DnaK. Members of this	90.71
COG1070		502	XylB Sugar (pentulose and hexulose) kinases [Carbo	90.57
PRK01433		595	hscA chaperone protein HscA; Provisional	90.53
KOG0681\|consensus		645		90.52
PTZ00281		376	actin; Provisional	90.21
PRK00290		627	dnaK molecular chaperone DnaK; Provisional	90.17
PTZ00466		380	actin-like protein; Provisional	89.64
PTZ00004		378	actin-2; Provisional	88.76
COG1069		544	AraB Ribulose kinase [Energy production and conver	88.24
PTZ00452		375	actin; Provisional	87.71
PRK05183		616	hscA chaperone protein HscA; Provisional	86.47
KOG0104\|consensus		902		85.72
PF07520		1002	SrfB: Virulence factor SrfB; InterPro: IPR009216 T	83.51
PLN02377		502	3-ketoacyl-CoA synthase	82.94
PRK11678		450	putative chaperone; Provisional	82.63
PLN03173		391	chalcone synthase; Provisional	81.56
COG5277		444	Actin and related proteins [Cytoskeleton]	81.34

>KOG0100\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.4e-79  Score=618.70  Aligned_cols=393  Identities=57%  Similarity=0.933  Sum_probs=380.3

Q ss_pred             ceEEEEEEEeCCCeEEEEEeCCCCCCchHHHHHHHHHHHHHHHhhhcccchhhhHHHHHHHHHHHHHHHHHhccCCceeE
Q psy4003           2 RTNGSVLAIDEGSLFQVKSTAGDTHLGGEDFDNRLVTFFADEFKRKHKKDILANTRAVRRLRTACERAKRTLSSSTEASL   81 (535)
Q Consensus         2 T~DvSvv~~~~~~~~~vl~~~g~~~lGG~dfD~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~~~e~aK~~LS~~~~~~i   81 (535)
                      |||||++.++.| .|+|++++||++|||+|||.++++||++-|+++++.++..+.+++++|+++||+||++||....+.+
T Consensus       236 TFDVSlLtIdnG-VFeVlaTnGDThLGGEDFD~rvm~~fiklykkK~gkDv~kdnkA~~KLrRe~EkAKRaLSsqhq~ri  314 (663)
T KOG0100|consen  236 TFDVSLLTIDNG-VFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKHGKDVRKDNKAVQKLRREVEKAKRALSSQHQVRI  314 (663)
T ss_pred             eEEEEEEEEcCc-eEEEEecCCCcccCccchHHHHHHHHHHHHhhhcCCccchhhHHHHHHHHHHHHHHhhhccccceEE
Confidence            899999999999 9999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecccCCeeeEEEeCHHHHHHHhhHHHHHhHHHHHHHHHHCCCCCCCccceeeeccccchhhhhhhhcCCCcccccchh
Q psy4003          82 EIDALHEGIDFYSKITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQIPPLIFRDFYS  161 (535)
Q Consensus        82 ~i~~~~~~~~~~~~ltr~~fe~l~~~~~~~~~~~i~~~l~~a~~~~~~~~~i~lvGGs~riP~vq~~~~~~~~~~~~~~~  161 (535)
                      .|+++++|.|++-++||..||++..++|+++..+++.+|+++++..+                                 
T Consensus       315 EIeS~fdG~DfSEtLtRAkFEElNmDLFr~TlkPv~kvl~Ds~lkKs---------------------------------  361 (663)
T KOG0100|consen  315 EIESLFDGVDFSETLTRAKFEELNMDLFRKTLKPVQKVLEDSDLKKS---------------------------------  361 (663)
T ss_pred             eeeeccccccccchhhhhHHHHhhhHHHHHhhHHHHHHHhhcCcccc---------------------------------
Confidence            99999999999999999988888888888888888888777777666                                 


Q ss_pred             hhhHHHHHHHHHHHHHhhhhHHHHHhhhcccCCCCcceEEEecCccccHHHHHHHHHhhCCCccCCCCCchhhHHhhHHH
Q psy4003         162 KITRARFEELCMDLFRQTLAPVERALNDAKLDKGSIHDVVLVGGSIRIPKIQKMLQDFFNGKSLNLSINPDEAVAYGAAV  241 (535)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~i~~V~LvGGssriP~v~~~l~~~f~~~~~~~~~~~deaVa~GAa~  241 (535)
                                                        |||.++|||||+|||.||++|+++|+|+++.+.+|||||||+|||.
T Consensus       362 ----------------------------------dideiVLVGGsTrIPKvQqllk~fF~GKepskGinPdEAVAYGAAV  407 (663)
T KOG0100|consen  362 ----------------------------------DIDEIVLVGGSTRIPKVQQLLKDFFNGKEPSKGINPDEAVAYGAAV  407 (663)
T ss_pred             ----------------------------------cCceEEEecCcccChhHHHHHHHHhCCCCccCCCChHHHHHhhhhh
Confidence                                              9999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCcccccceeeeecccCcceeEeeCCEEEEEEecCCccCcceeEEEEcCCCCCCCCCccCCcCCCCCCCCCcc
Q psy4003         242 QAAILSGDTSSAIQDVLLVDVAPLSLGIETAGGVMTKIVERNSRIPCKQQQTFTEQPSKLPSSVETPVLPSKMSCWPDAI  321 (535)
Q Consensus       242 ~a~~l~~~~~~~~~~~~~~d~~~~~~gi~~~~~~~~~i~~~~~~iP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  321 (535)
                      +|..++|  .+...++++.|++|.++||++.+|+|++||++|+.+|.++++.|++.                        
T Consensus       408 QaGvlsG--ee~t~divLLDv~pLtlGIETvGGVMTklI~RNTviPTkKSQvFsTa------------------------  461 (663)
T KOG0100|consen  408 QAGVLSG--EEDTGDIVLLDVNPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTA------------------------  461 (663)
T ss_pred             hhccccc--ccCcCcEEEEeeccccceeeeecceeeccccCCcccCccccceeeec------------------------
Confidence            9999999  67778999999999999999999999999999999999999999998                        


Q ss_pred             CCccccCCcccccccccceeeccccccccCCCCCCCCCCCCCccccCCCCcceEEEEEecCcccccCCCceeeEEEcCCC
Q psy4003         322 GGQLRFTPECCHYSELSIMYVGNITTWRTNSHFNPIPLFQPKSFSHSRYQNAVTIQVFEGERAMTKDNNLLGTFNLTGIP  401 (535)
Q Consensus       322 ~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~i~v~~g~~~~~~~~~~ig~~~i~~~~  401 (535)
                                                                    .|+|+.++|+||+|++.++.+|+++|+|.++|+|
T Consensus       462 ----------------------------------------------~DnQ~tV~I~vyEGER~mtkdn~lLGkFdltGip  495 (663)
T KOG0100|consen  462 ----------------------------------------------QDNQPTVTIQVYEGERPMTKDNHLLGKFDLTGIP  495 (663)
T ss_pred             ----------------------------------------------ccCCceEEEEEeeccccccccccccccccccCCC
Confidence                                                          8999999999999999999999999999999999


Q ss_pred             CCCCCCCeEEEEEEeCCCceEEEEEeecCCCcceeEEEecCCCCCCHHHHHHHHHHHHHHHhhchHHHHHHHHHhhHHHH
Q psy4003         402 PAPRGVPKIEVTFDLDANGILNVSAKDSSTGKAERITIQNDKGRLSKDDIDRMLAEAEKYKAEDDKQRERVAAKNKLESY  481 (535)
Q Consensus       402 ~~~~g~~~I~v~f~id~nGil~v~~~~~~t~k~~~i~i~~~~~~Ls~eei~~~~~~l~~l~~~D~~~~e~~~akN~LEs~  481 (535)
                      |+|+|.|+|+|+|.+|.||+|+|++.+..+|+..+++|+|+..+||.|+|++|.+.+++|..+|+..+++.++||+||+|
T Consensus       496 PAPRGvpqIEVtFevDangiL~VsAeDKgtg~~~kitItNd~~rLt~EdIerMv~eAekFAeeDk~~KekieaRN~LE~Y  575 (663)
T KOG0100|consen  496 PAPRGVPQIEVTFEVDANGILQVSAEDKGTGKKEKITITNDKGRLTPEDIERMVNEAEKFAEEDKKLKEKIEARNELESY  575 (663)
T ss_pred             CCCCCCccEEEEEEEccCceEEEEeeccCCCCcceEEEecCCCCCCHHHHHHHHHHHHHHhhhhHHHHHHHHhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcC---CCCCHHHHHHHHHHHHHHHHHHccCCccCHHHHHHHHHHhh
Q psy4003         482 AFAVKQAAEDSG---SKLSDADKTSVSQACSATLTWLEGNSLAEKEEFEDRLKTLQ  534 (535)
Q Consensus       482 Iy~~r~~Le~~~---~~~t~~ek~~i~~~l~e~~~WL~~~~~~~~~~~~~~l~~L~  534 (535)
                      .|.+++.+.+.+   ..+++++++.+..++++..+||++|.+|++++|.++.++|+
T Consensus       576 ayslKnqi~dkekLg~Kl~~edKe~~e~av~e~~eWL~~n~~a~~Ee~~ek~kele  631 (663)
T KOG0100|consen  576 AYSLKNQIGDKEKLGGKLSDEDKETIEDAVEEALEWLESNQDASKEEFKEKKKELE  631 (663)
T ss_pred             HHHhhhccCchhHhcccCChhHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHH
Confidence            999999998775   88999999999999999999999999999999999999986

>PTZ00009 heat shock 70 kDa protein; Provisional	Back alignment and domain information

>KOG0101\|consensus	Back alignment and domain information

>PRK13411 molecular chaperone DnaK; Provisional	Back alignment and domain information

>PTZ00186 heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>PRK13410 molecular chaperone DnaK; Provisional	Back alignment and domain information

>PLN03184 chloroplast Hsp70; Provisional	Back alignment and domain information

>PTZ00400 DnaK-type molecular chaperone; Provisional	Back alignment and domain information

>PRK00290 dnaK molecular chaperone DnaK; Provisional	Back alignment and domain information

>TIGR02350 prok_dnaK chaperone protein DnaK	Back alignment and domain information

>CHL00094 dnaK heat shock protein 70	Back alignment and domain information

>TIGR01991 HscA Fe-S protein assembly chaperone HscA	Back alignment and domain information

>PRK05183 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>KOG0102\|consensus	Back alignment and domain information

>PRK01433 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins	Back alignment and domain information

>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0103\|consensus	Back alignment and domain information

>KOG0104\|consensus	Back alignment and domain information

>PRK11678 putative chaperone; Provisional	Back alignment and domain information

>PRK13928 rod shape-determining protein Mbl; Provisional	Back alignment and domain information

>PRK13927 rod shape-determining protein MreB; Provisional	Back alignment and domain information

>PRK13929 rod-share determining protein MreBH; Provisional	Back alignment and domain information

>TIGR00904 mreB cell shape determining protein, MreB/Mrl family	Back alignment and domain information

>PRK13930 rod shape-determining protein MreB; Provisional	Back alignment and domain information

>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes	Back alignment and domain information

>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein	Back alignment and domain information

>PRK15080 ethanolamine utilization protein EutJ; Provisional	Back alignment and domain information

>TIGR01174 ftsA cell division protein FtsA	Back alignment and domain information

>PRK09472 ftsA cell division protein FtsA; Reviewed	Back alignment and domain information

>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning]	Back alignment and domain information

>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK13917 plasmid segregation protein ParM; Provisional	Back alignment and domain information

>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A	Back alignment and domain information

>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative	Back alignment and domain information

>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton	Back alignment and domain information

>KOG0100\|consensus	Back alignment and domain information

>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related	Back alignment and domain information

>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit	Back alignment and domain information

>smart00268 ACTIN Actin	Back alignment and domain information

>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D	Back alignment and domain information

>PRK15027 xylulokinase; Provisional	Back alignment and domain information

>TIGR01175 pilM type IV pilus assembly protein PilM	Back alignment and domain information

>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A	Back alignment and domain information

>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15	Back alignment and domain information

>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03739 PRTRC_D PRTRC system protein D	Back alignment and domain information

>PLN02669 xylulokinase	Back alignment and domain information

>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase	Back alignment and domain information

>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton	Back alignment and domain information

>TIGR02628 fuculo_kin_coli L-fuculokinase	Back alignment and domain information

>TIGR01312 XylB D-xylulose kinase	Back alignment and domain information

>TIGR01234 L-ribulokinase L-ribulokinase	Back alignment and domain information

>PTZ00280 Actin-related protein 3; Provisional	Back alignment and domain information

>PRK00047 glpK glycerol kinase; Provisional	Back alignment and domain information

>PRK04123 ribulokinase; Provisional	Back alignment and domain information

>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism]	Back alignment and domain information

>TIGR01311 glycerol_kin glycerol kinase	Back alignment and domain information

>PTZ00294 glycerol kinase-like protein; Provisional	Back alignment and domain information

>PTZ00186 heat shock 70 kDa precursor protein; Provisional	Back alignment and domain information

>TIGR01314 gntK_FGGY gluconate kinase, FGGY type	Back alignment and domain information

>PRK10331 L-fuculokinase; Provisional	Back alignment and domain information

>PLN02295 glycerol kinase	Back alignment and domain information

>PRK13317 pantothenate kinase; Provisional	Back alignment and domain information

>TIGR02627 rhamnulo_kin rhamnulokinase	Back alignment and domain information

>PRK10640 rhaB rhamnulokinase; Provisional	Back alignment and domain information

>KOG2531\|consensus	Back alignment and domain information

>PRK10939 autoinducer-2 (AI-2) kinase; Provisional	Back alignment and domain information

>PRK13410 molecular chaperone DnaK; Provisional	Back alignment and domain information

>KOG0102\|consensus	Back alignment and domain information

>KOG2517\|consensus	Back alignment and domain information

>KOG0101\|consensus	Back alignment and domain information

>PLN03184 chloroplast Hsp70; Provisional	Back alignment and domain information

>CHL00094 dnaK heat shock protein 70	Back alignment and domain information

>TIGR02350 prok_dnaK chaperone protein DnaK	Back alignment and domain information

>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK01433 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>KOG0681\|consensus	Back alignment and domain information

>PTZ00281 actin; Provisional	Back alignment and domain information

>PRK00290 dnaK molecular chaperone DnaK; Provisional	Back alignment and domain information

>PTZ00466 actin-like protein; Provisional	Back alignment and domain information

>PTZ00004 actin-2; Provisional	Back alignment and domain information

>COG1069 AraB Ribulose kinase [Energy production and conversion]	Back alignment and domain information

>PTZ00452 actin; Provisional	Back alignment and domain information

>PRK05183 hscA chaperone protein HscA; Provisional	Back alignment and domain information

>KOG0104\|consensus	Back alignment and domain information

>PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function	Back alignment and domain information

>PLN02377 3-ketoacyl-CoA synthase	Back alignment and domain information

>PRK11678 putative chaperone; Provisional	Back alignment and domain information

>PLN03173 chalcone synthase; Provisional	Back alignment and domain information

>COG5277 Actin and related proteins [Cytoskeleton]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		535
3a8y_A		392	Crystal Structure Of The Complex Between The Bag5 B		3e-63
3a8y_A		392	Crystal Structure Of The Complex Between The Bag5 B		7e-33
3jxu_A		409	Crystal Structure Of The Human 70kda Heat Shock Pro		3e-63
3jxu_A		409	Crystal Structure Of The Human 70kda Heat Shock Pro		8e-33
2e8a_A		391	Crystal Structure Of The Human Hsp70 Atpase Domain		4e-63
2e8a_A		391	Crystal Structure Of The Human Hsp70 Atpase Domain		7e-33
2e88_A		391	Crystal Structure Of The Human Hsp70 Atpase Domain		4e-63
2e88_A		391	Crystal Structure Of The Human Hsp70 Atpase Domain		7e-33
3d2f_B		382	Crystal Structure Of A Complex Of Sse1p And Hsp70 L		4e-63
3d2f_B		382	Crystal Structure Of A Complex Of Sse1p And Hsp70 L		8e-32
1s3x_A		382	The Crystal Structure Of The Human Hsp70 Atpase Dom		4e-63
1s3x_A		382	The Crystal Structure Of The Human Hsp70 Atpase Dom		8e-32
3d2e_B		382	Crystal Structure Of A Complex Of Sse1p And Hsp70,		4e-63
3d2e_B		382	Crystal Structure Of A Complex Of Sse1p And Hsp70,		6e-32
1hjo_A		380	Atpase Domain Of Human Heat Shock 70kda Protein 1 L		5e-63
1hjo_A		380	Atpase Domain Of Human Heat Shock 70kda Protein 1 L		9e-32
3gdq_A		408	Crystal Structure Of The Human 70kda Heat Shock Pro		5e-63
3gdq_A		408	Crystal Structure Of The Human 70kda Heat Shock Pro		8e-32
1xqs_C		191	Crystal Structure Of The Hspbp1 Core Domain Complex		1e-62
1xqs_C		191	Crystal Structure Of The Hspbp1 Core Domain Complex		5e-31
3c7n_B		554	Structure Of The Hsp110:hsc70 Nucleotide Exchange C		1e-61
3c7n_B		554	Structure Of The Hsp110:hsc70 Nucleotide Exchange C		5e-52
3c7n_B		554	Structure Of The Hsp110:hsc70 Nucleotide Exchange C		2e-50
1ngd_A		386	Structural Basis Of The 70-kilodalton Heat Shock Co		1e-61
1ngd_A		386	Structural Basis Of The 70-kilodalton Heat Shock Co		1e-32
1ba1_A		386	Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi		2e-61
1ba1_A		386	Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi		9e-33
2bup_A		381	T13g Mutant Of The Atpase Fragment Of Bovine Hsc70		2e-61
2bup_A		381	T13g Mutant Of The Atpase Fragment Of Bovine Hsc70		5e-31
3fe1_A		403	Crystal Structure Of The Human 70kda Heat Shock Pro		2e-61
3fe1_A		403	Crystal Structure Of The Human 70kda Heat Shock Pro		4e-33
1ngg_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		2e-61
1ngg_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		1e-32
1ngc_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		2e-61
1ngc_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		1e-32
1nge_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		2e-61
1nge_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		1e-32
1qqo_A		378	E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro		2e-61
1qqo_A		378	E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro		5e-31
1kaz_A		381	70kd Heat Shock Cognate Protein Atpase Domain, K71e		2e-61
1kaz_A		381	70kd Heat Shock Cognate Protein Atpase Domain, K71e		5e-31
3fzf_A		381	Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP		2e-61
3fzf_A		381	Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP		5e-31
2qw9_B		394	Crystal Structure Of Bovine Hsc70 (1-394aa)in The A		2e-61
2qw9_B		394	Crystal Structure Of Bovine Hsc70 (1-394aa)in The A		3e-35
1ba0_A		386	Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi		2e-61
1ba0_A		386	Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi		1e-32
1bup_A		386	T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot		2e-61
1bup_A		386	T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot		1e-32
1ngf_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		2e-61
1ngf_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		1e-32
1nga_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		2e-61
1nga_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		1e-32
1ngb_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		2e-61
1ngb_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		1e-32
1ngh_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		2e-61
1ngh_A		386	Structural Basis Of The 70-Kilodalton Heat Shock Co		1e-32
1kay_A		381	70kd Heat Shock Cognate Protein Atpase Domain, K71a		2e-61
1kay_A		381	70kd Heat Shock Cognate Protein Atpase Domain, K71a		5e-31
3cqx_A		386	Chaperone Complex Length = 386		2e-61
3cqx_A		386	Chaperone Complex Length = 386		5e-31
1kax_A		381	70kd Heat Shock Cognate Protein Atpase Domain, K71m		2e-61
1kax_A		381	70kd Heat Shock Cognate Protein Atpase Domain, K71m		6e-31
1hpm_A		386	How Potassium Affects The Activity Of The Molecular		3e-61
1hpm_A		386	How Potassium Affects The Activity Of The Molecular		1e-32
2qwn_A		394	Crystal Structure Of Disulfide-Bond-Crosslinked Com		3e-61
1ats_A		386	Threonine 204 Of The Chaperone Protein Hsc70 Influe		3e-61
1ats_A		386	Threonine 204 Of The Chaperone Protein Hsc70 Influe		1e-32
1atr_A		386	Threonine 204 Of The Chaperone Protein Hsc70 Influe		3e-61
1atr_A		386	Threonine 204 Of The Chaperone Protein Hsc70 Influe		1e-32
1hx1_A		400	Crystal Structure Of A Bag Domain In Complex With T		3e-61
1hx1_A		400	Crystal Structure Of A Bag Domain In Complex With T		6e-31
1yuw_A		554	Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214		4e-61
1yuw_A		554	Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214		4e-52
1yuw_A		554	Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214		2e-50
2v7z_A		543	Crystal Structure Of The 70-Kda Heat Shock Cognate		5e-61
2v7z_A		543	Crystal Structure Of The 70-Kda Heat Shock Cognate		5e-52
2v7z_A		543	Crystal Structure Of The 70-Kda Heat Shock Cognate		9e-47
3i33_A		404	Crystal Structure Of The Human 70kda Heat Shock Pro		7e-61
3i33_A		404	Crystal Structure Of The Human 70kda Heat Shock Pro		5e-31
4fsv_A		387	Crystal Structure Of A Heat Shock 70kda Protein 2 (		2e-60
4fsv_A		387	Crystal Structure Of A Heat Shock 70kda Protein 2 (		5e-31
1qqm_A		378	D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro		4e-60
1qqm_A		378	D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro		4e-31
1qqn_A		378	D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro		2e-59
3kvg_A		400	Crystal Structure Of The N-Terminal Domain Of Hsp70		1e-52
3kvg_A		400	Crystal Structure Of The N-Terminal Domain Of Hsp70		1e-25
1ckr_A		159	High Resolution Solution Structure Of The Heat Shoc		3e-47
3dob_A		152	Peptide-Binding Domain Of Heat Shock 70 Kda Protein		1e-42
3gl1_A		387	Crystal Structure Of Atpase Domain Of Ssb1 Chaperon		2e-41
3gl1_A		387	Crystal Structure Of Atpase Domain Of Ssb1 Chaperon		1e-22
3iuc_A		408	Crystal Structure Of The Human 70kda Heat Shock Pro		8e-39
3iuc_A		408	Crystal Structure Of The Human 70kda Heat Shock Pro		2e-22
3ldl_A		384	Crystal Structure Of Human Grp78 (70kda Heat Shock		1e-38
3ldl_A		384	Crystal Structure Of Human Grp78 (70kda Heat Shock		7e-22
3h0x_A		152	Crystal Structure Of Peptide-Binding Domain Of Kar2		1e-38
3qfp_A		390	Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D		1e-37
3qfp_A		390	Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D		3e-20
3qfu_A		394	Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE		1e-37
3qfu_A		394	Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE		3e-20
2kho_A		605	Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP		2e-34
2kho_A		605	Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP		3e-32
2op6_A		152	Peptide-Binding Domain Of Heat Shock 70 Kda Protein		1e-33
3n8e_A		182	Substrate Binding Domain Of The Human Heat Shock 70		3e-32
3dpo_A		219	Crystal Structure Of The Substrate Binding Domain O		8e-32
3dqg_A		151	Peptide-Binding Domain Of Heat Shock 70 Kda Protein		9e-32
1dkx_A		219	The Substrate Binding Domain Of Dnak In Complex Wit		1e-31
1dky_A		219	The Substrate Binding Domain Of Dnak In Complex Wit		2e-31
4b9q_A		605	Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L		2e-30
1bpr_A		191	Nmr Structure Of The Substrate Binding Domain Of Dn		2e-27
2v7y_A		509	Crystal Structure Of The Molecular Chaperone Dnak F		6e-27
2v7y_A		509	Crystal Structure Of The Molecular Chaperone Dnak F		1e-26
2v7y_A		509	Crystal Structure Of The Molecular Chaperone Dnak F		7e-26
3c7n_A		668	Structure Of The Hsp110:hsc70 Nucleotide Exchange C		3e-23
2qxl_A		658	Crystal Structure Analysis Of Sse1, A Yeast Hsp110		3e-23
3d2f_A		675	Crystal Structure Of A Complex Of Sse1p And Hsp70 L		5e-23
1dkg_D		383	Crystal Structure Of The Nucleotide Exchange Factor		6e-23
3d2e_A		675	Crystal Structure Of A Complex Of Sse1p And Hsp70,		1e-22
3d2e_A		675	Crystal Structure Of A Complex Of Sse1p And Hsp70,		1e-06
1dg4_A		115	Nmr Structure Of The Substrate Binding Domain Of Dn		5e-21
1q5l_A		135	Nmr Structure Of The Substrate Binding Domain Of Dn		5e-21
4gni_A		409	Structure Of The Ssz1 Atpase Bound To Atp And Magne		2e-15
1u00_A		227	Hsca Substrate Binding Domain Complexed With The Is		3e-13
3lof_A		113	C-Terminal Domain Of Human Heat Shock 70kda Protein		5e-13
2lmg_A		75	Solution Structure Of The C-Terminal Domain (537-61		1e-11
2p32_A		120	Crystal Structure Of The C-Terminal 10 Kda Subdomai		3e-07
1ud0_A		113	Crystal Structure Of The C-Terminal 10-Kda Subdomai		2e-06

>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392