Diaphorina citri psyllid: psy4005

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MYLCFANRIFYYYLEPHVLLFRRPKQPTPTSCSCGNNSVQEESAYGKFEFCRAAAAPSLIPVSSCLLAFTVSSFSGKTTTMSADDIRYSDKYEDDNYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLPGNENWVKNRYETLVRLRGKRDFSVLSQQDKQGGHVGYARLKCCEHHKRGSTQDLKIPEQR
ccEEEEcEEEEEECccCEEEECcccccccccccccccccccHHcccHHHHHHHccccccccccccccccccccccccccccccccCEEccccccccCEEEEEEccHHHHHcccccccccHHHHHHHcccccccCEEEECcccccCEEEEccccccccccccccccHHHHHHHccccccEEEEEcHHcccccccccccccccc
*YLCFANRIFYYYLEPHVLLFRR*******************SAYGKFEFCRAAAAPSLIPVSSCLLAFTVSSFSGKTTTMSADDIRYSDKYEDDNYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLPGNENWVKNRYETLVRLRGKRDFSVLSQQDKQGGHVGYARLKCCEH***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLCFANRIFYYYLEPHVLLFRRPKQPTPTSCSCGNNSVQEESAYGKFEFCRAAAAPSLIPVSSCLLAFTVSSFSGKTTTMSADDIRYSDKYEDDNYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLPGNENWVKNRYETLVRLRGKRDFSVLSQQDKQGGHVGYARLKCCEHHKRGSTQDLKIPEQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-dependent kinases regulatory subunit 1 Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.confidentQ0P5A5
Cyclin-dependent kinases regulatory subunit 1 Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.confidentP61025
Cyclin-dependent kinases regulatory subunit 1 Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.confidentP61024

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019005 [CC]SCF ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0000080 [BP]G1 phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0051318, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0016538 [MF]cyclin-dependent protein serine/threonine kinase regulator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0019887
GO:0007057 [BP]spindle assembly involved in female meiosis IprobableGO:0048610, GO:0070271, GO:0043933, GO:0090306, GO:0022607, GO:0022402, GO:0007144, GO:0007143, GO:0044699, GO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0071822, GO:0071840, GO:0016043, GO:0051225, GO:0065003, GO:0007049, GO:0006461, GO:0000212, GO:0009987, GO:0007051, GO:0000226, GO:0008150, GO:0007056, GO:0070925, GO:0006996, GO:0007017, GO:0007010, GO:0044085, GO:0044763
GO:0035186 [BP]syncytial blastoderm mitotic cell cycleprobableGO:0032502, GO:0044699, GO:0032501, GO:0000278, GO:0044707, GO:0009987, GO:0048856, GO:0044767, GO:0009790, GO:0044763, GO:0045448, GO:0008150, GO:0033301, GO:0007275, GO:0007049
GO:0007113 [BP]endomitotic cell cycleprobableGO:0000278, GO:0009987, GO:0008150, GO:0007049, GO:0044763, GO:0044699
GO:0008054 [BP]cyclin catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0007488 [BP]histoblast morphogenesisprobableGO:0032502, GO:0009791, GO:0048707, GO:0009886, GO:0044707, GO:0007444, GO:0048569, GO:0032501, GO:0007552, GO:0007560, GO:0048563, GO:0044767, GO:0002165, GO:0048513, GO:0008150, GO:0009887, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0048856
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0000079 [BP]regulation of cyclin-dependent protein serine/threonine kinase activityprobableGO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0071900, GO:0050789, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051726, GO:0051338, GO:0001932

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QY2, chain A
Confidence level:very confident
Coverage over the Query: 75-154
View the alignment between query and template
View the model in PyMOL