Diaphorina citri psyllid: psy4009


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
ISPDKVQFKEDKEEGGVQTWRLLLCLKSSSQTKLVYSLYRQTRFSSRRIRRRVVFKHGDCNVVQENVAKRRRRYLQDIFTTLVDAQWRWTLLVFALNFLLSWLMFAIVWWLIVYTHGDLDKVNLGNATWTPCVTSIHSFTSCFLFSVETQHTIGYGAKQVTEECPEAIFILCLQSIVGVMIQAFMVGIVFAKLSRPKKRTQTLLFSRINCLQTSVEDKIFFIWPTTIVHKINPMSPLYTLSAADMLRERFEIVVILEGVIESTGMTTQARSSYLPNEILWGHRFETLVSFKKETGEHEVNYGLFNNTYEVHTPLCSAQALDQLLAIHGTTKSNADISVSPGDAPSNARNLSSDDANNNSNNKPEGVKQGSELSPGNGSCVVQLLPGPESNL
cccccccECcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEcCECccccEEEEccccEEEEEcccccccccccHHHHHcccEEEEEEEEEEEccccCEEEEEEEECcccEEcccEEcccEEEEccccEEEEEccccccCEECccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***************GVQTWRLLLCLKSSSQTKLVYSLYRQTRFSSRRIRRRVVFKHGDCNVVQENVAKRRRRYLQDIFTTLVDAQWRWTLLVFALNFLLSWLMFAIVWWLIVYTHGDLDKVNLGNATWTPCVTSIHSFTSCFLFSVETQHTIGYGAKQVTEECPEAIFILCLQSIVGVMIQAFMVGIVFAKLSRPKKRTQTLLFSRINCLQTSVEDKIFFIWPTTIVHKINPMSPLYTLSAADMLRERFEIVVILEGVIESTGMTTQARSSYLPNEILWGHRFETLVSFKKETGEHEVNYGLFNNTYEVHTPLCSAQALDQLLAIH****************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ISPDKVQFKEDKEEGGVQTWRLLLCLKSSSQTKLVYSLYRQTRFSSRRIRRRVVFKHGDCNVVQENVAKRRRRYLQDIFTTLVDAQWRWTLLVFALNFLLSWLMFAIVWWLIVYTHGDLDKVNLGNATWTPCVTSIHSFTSCFLFSVETQHTIGYGAKQVTEECPEAIFILCLQSIVGVMIQAFMVGIVFAKLSRPKKRTQTLLFSRINCLQTSVEDKIFFIWPTTIVHKINPMSPLYTLSAADMLRERFEIVVILEGVIESTGMTTQARSSYLPNEILWGHRFETLVSFKKETGEHEVNYGLFNNTYEVHTPLCSAQALDQLLAIHGTTKSNADISVSPGDAPSNARNLSSDDANNNSNNKPEGVKQGSELSPGNGSCVVQLLPGPESNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-sensitive inward rectifier potassium channel 12 Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium.confidentP52188
ATP-sensitive inward rectifier potassium channel 12 Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium.confidentQ4TZY1
Inward rectifier potassium channel 2 Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium.confidentO18839

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0030315 [CC]T-tubuleprobableGO:0042383, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0042391 [BP]regulation of membrane potentialprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0015693 [BP]magnesium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SYA, chain A
Confidence level:very confident
Coverage over the Query: 50-325
View the alignment between query and template
View the model in PyMOL