Diaphorina citri psyllid: psy4019

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11

MKLNLAYPLLSSQKPYVCGEENCTKRYTDPSSLRKHIKTVHGEHCYANKKHKGMPSKDKDGLGGASPSRSDDMPLSAKTASVSSPSIKSEVSVDLDPLSPSSRSLQLED

ccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

******YPLLSSQKPYVCGEENCTKRYTDPSSLRKHIKTVHGEHCY***************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKLNLAYPLLSSQKPYVCGEENCTKRYTDPSSLRKHIKTVHGEHCYANKKHKGMPSKDKDGLGGASPSRSDDMPLSAKTASVSSPSIKSEVSVDLDPLSPSSRSLQLED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcriptional activator cubitus interruptus	Has a dual function as a transcriptional activator and a repressor of the hedgehog (Hh) pathway. The full-length ci form (ciFL), acts as an activator (ciA) while ciR, its C-terminally truncated form, acts as a repressor. Involved in segment polarity. Required for the normal development of the posterior half of each embryonic segment. Engrailed protein directly represses ci expression in posterior compartment cells.	confident	P19538

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0031513 [CC]	nonmotile primary cilium	probable	GO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0030855 [BP]	epithelial cell differentiation	probable	GO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0009888, GO:0044763, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0030858 [BP]	positive regulation of epithelial cell differentiation	probable	GO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0030856, GO:0050789, GO:0048522
GO:0021517 [BP]	ventral spinal cord development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0021510, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0035277 [BP]	spiracle morphogenesis, open tracheal system	probable	GO:0032502, GO:0007424, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0048100 [BP]	wing disc anterior/posterior pattern formation	probable	GO:0032502, GO:0007389, GO:0048856, GO:0007447, GO:0009952, GO:0044707, GO:0007444, GO:0032501, GO:0007448, GO:0035222, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0048562 [BP]	embryonic organ morphogenesis	probable	GO:0048598, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0016607 [CC]	nuclear speck	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0042826 [MF]	histone deacetylase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0035301 [CC]	Hedgehog signaling complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0060914 [BP]	heart formation	probable	GO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0008150, GO:0048513, GO:0048856, GO:0007275, GO:0003007, GO:0072359, GO:0072358, GO:0044767, GO:0044699, GO:0048731, GO:0009653, GO:0048645, GO:0048646
GO:0048813 [BP]	dendrite morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0035017 [BP]	cuticle pattern formation	probable	GO:0032502, GO:0007389, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0030707 [BP]	ovarian follicle cell development	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0007276, GO:0000003, GO:0048869, GO:0044699, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0009953 [BP]	dorsal/ventral pattern formation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0045880 [BP]	positive regulation of smoothened signaling pathway	probable	GO:0008589, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0051960 [BP]	regulation of nervous system development	probable	GO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0090090 [BP]	negative regulation of canonical Wnt receptor signaling pathway	probable	GO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0030178, GO:0060828
GO:0048592 [BP]	eye morphogenesis	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0007367 [BP]	segment polarity determination	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0007365, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007224 [BP]	smoothened signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0048566 [BP]	embryonic digestive tract development	probable	GO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048568, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0021953 [BP]	central nervous system neuron differentiation	probable	GO:0032502, GO:0048699, GO:0048856, GO:0030182, GO:0007399, GO:0044707, GO:0048869, GO:0009987, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0007417
GO:0048855 [BP]	adenohypophysis morphogenesis	probable	GO:0021536, GO:0021983, GO:0009653, GO:0007275, GO:0021984, GO:0007417, GO:0048513, GO:0044699, GO:0022612, GO:0032502, GO:0009887, GO:0032501, GO:0044767, GO:0035270, GO:0008150, GO:0007420, GO:0044707, GO:0048854, GO:0048856, GO:0048850, GO:0048853, GO:0048852, GO:0007399, GO:0030900, GO:0048731, GO:0048732
GO:0045750 [BP]	positive regulation of S phase of mitotic cell cycle	probable
GO:0001162 [MF]	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	probable	GO:0044213, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001161, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0035295 [BP]	tube development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0003705 [MF]	RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0021515 [BP]	cell differentiation in spinal cord	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0021510, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0007417
GO:0001077 [MF]	RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription	probable	GO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0016592 [CC]	mediator complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001708 [BP]	cell fate specification	probable	GO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0008544 [BP]	epidermis development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:2000179 [BP]	positive regulation of neural precursor cell proliferation	probable	GO:0008284, GO:0042127, GO:0050794, GO:2000177, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016485 [BP]	protein processing	probable	GO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0035217 [BP]	labial disc development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0030902 [BP]	hindbrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0060173 [BP]	limb development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0007275, GO:0048736
GO:0007346 [BP]	regulation of mitotic cell cycle	probable	GO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0017053 [CC]	transcriptional repressor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000980 [MF]	RNA polymerase II distal enhancer sequence-specific DNA binding	probable	GO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0035224 [BP]	genital disc anterior/posterior pattern formation	probable	GO:0032502, GO:0007389, GO:0035215, GO:0048856, GO:0007447, GO:0009952, GO:0044707, GO:0007444, GO:0032501, GO:0007448, GO:0035221, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0007411 [BP]	axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0019101 [BP]	female somatic sex determination	probable	GO:0032502, GO:0032501, GO:0018993, GO:0044707, GO:0022414, GO:0000003, GO:0030237, GO:0003006, GO:0008150, GO:0007275, GO:0044699, GO:0007530
GO:0042476 [BP]	odontogenesis	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GLI, chain A
Confidence level:very confident
Coverage over the Query: 2-49,62-90
View the alignment between query and template
View the model in PyMOL