Diaphorina citri psyllid: psy4027


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
cEEEEEEcccccccEEEEccEEEEcccccccccccccccEEEEEEcccEEEEEccccccCECccccEEEEccccEEEcccEEEEEEccccccccccccccccccEEEEcccccCEEccccccccccccccccccccccEEEEEEEEEcc
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
FK506-binding protein 2 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.confidentP0CP96

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044432 [CC]endoplasmic reticulum partprobableGO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:1901363 [MF]heterocyclic compound bindingprobableGO:0003674, GO:0005488
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0097159 [MF]organic cyclic compound bindingprobableGO:0003674, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JXV, chain A
Confidence level:very confident
Coverage over the Query: 75-148
View the alignment between query and template
View the model in PyMOL
Template: 1NLQ, chain A
Confidence level:confident
Coverage over the Query: 1-90
View the alignment between query and template
View the model in PyMOL