Psyllid ID: psy4027

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
cEEEEEEcccccccEEEEccEEEEcccccccccccccccEEEEEEcccEEEEEccccccEEEccccEEEEccccEEEcccEEEEEEccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccEEEEEEEEEcc
cEEEEEEcccccEEEEEEccEEEEEEcccccccccccccEEEEEccccEEEEEEcccccccccccccEEEcccccccccccEEEEEEEEcccccEEccccccccEEEEcccccccHHHHcccccccccEcccEcccccEEEEEEEEEEc
mfwgfvlepkkrynttvtkpfhismaaldpksitdneVSSLVLNVDGTETILcnlgkpnylqerLDLNFIEGNTITLEVKGKATVHLSVKsnnqqfdsstqgpgfkfrlgkgevikgwdvdeedgnkgsppaippnstlVFDVELKNVN
mfwgfvlepkkrynttvtkpfhismaaldpksiTDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKsnnqqfdsstqgpgfkfrlGKGEVIKGWDVDEEdgnkgsppaippnstlvfdveLKNVN
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
*FWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLS****************FKFRLGKGEVIKGWD******************************
MFWGFVLEPKKRYNTTVTKPFHI*****************************CNLGKPNYLQERL**NFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLSVKSNNQQFDSSTQGPGFKFRLGKGEVIKGWDVDEEDGNKGSPPAIPPNSTLVFDVELKNVN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q26486 412 46 kDa FK506-binding nucl N/A N/A 0.583 0.211 0.443 7e-16
P54397357 39 kDa FK506-binding nucl yes N/A 0.409 0.170 0.487 2e-11
P0C1J6 382 FK506-binding protein 4 O N/A N/A 0.832 0.324 0.321 2e-11
Q54NB6364 FK506-binding protein 4 O yes N/A 0.362 0.148 0.444 2e-09
P27124 458 Peptidyl-prolyl cis-trans yes N/A 0.362 0.117 0.444 3e-08
Q9QVC8 458 Peptidyl-prolyl cis-trans yes N/A 0.362 0.117 0.444 3e-08
Q38936163 Peptidyl-prolyl cis-trans yes N/A 0.483 0.441 0.402 3e-08
P0CP96141 FK506-binding protein 2 O yes N/A 0.677 0.716 0.304 4e-08
P0CP97141 FK506-binding protein 2 O N/A N/A 0.677 0.716 0.304 4e-08
P30416 458 Peptidyl-prolyl cis-trans yes N/A 0.362 0.117 0.444 5e-08
>sp|Q26486|FKBP4_SPOFR 46 kDa FK506-binding nuclear protein OS=Spodoptera frugiperda GN=FKBP46 PE=2 SV=1 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 1/88 (1%)

Query: 1  MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNY 60
          MFWG ++EP KRY   V KPFHIS AA+D  S  DN+   +++ VDG   ++C L K   
Sbjct: 1  MFWGLIMEPNKRYTQVVEKPFHISQAAMDI-STGDNDPCQVMVVVDGKNFLVCTLQKGKI 59

Query: 61 LQERLDLNFIEGNTITLEVKGKATVHLS 88
          +Q  LDL F  G++++    GK  VHL+
Sbjct: 60 IQVPLDLYFKSGDSVSFLTNGKCNVHLT 87
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Binds double-stranded DNA in vitro.
Spodoptera frugiperda (taxid: 7108)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P54397|FKB39_DROME 39 kDa FK506-binding nuclear protein OS=Drosophila melanogaster GN=FK506-bp1 PE=1 SV=2 Back     alignment and function description
>sp|P0C1J6|FKBP4_RHIO9 FK506-binding protein 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP4 PE=3 SV=1 Back     alignment and function description
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description
>sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 Back     alignment and function description
>sp|Q38936|FK152_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-2 OS=Arabidopsis thaliana GN=FKBP15-2 PE=2 SV=2 Back     alignment and function description
>sp|P0CP96|FKBP2_CRYNJ FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR2 PE=3 SV=1 Back     alignment and function description
>sp|P0CP97|FKBP2_CRYNB FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR2 PE=3 SV=1 Back     alignment and function description
>sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
312986077 418 FKBP46 [Penaeus monodon] 0.590 0.210 0.488 2e-15
350412899 356 PREDICTED: hypothetical protein LOC10074 0.583 0.244 0.488 2e-15
321470537 361 hypothetical protein DAPPUDRAFT_196224 [ 0.577 0.238 0.516 3e-15
170046878 379 46 kDa FK506-binding nuclear protein [Cu 0.402 0.158 0.571 4e-15
328792386 354 PREDICTED: hypothetical protein LOC72597 0.583 0.245 0.477 1e-14
380026681 352 PREDICTED: uncharacterized protein LOC10 0.583 0.247 0.477 1e-14
157135619 289 hypothetical protein AaeL_AAEL003303 [Ae 0.402 0.207 0.558 1e-14
112983564 402 45 kDa immunophilin FKBP45 [Bombyx mori] 0.583 0.216 0.465 2e-14
332373964 283 unknown [Dendroctonus ponderosae] 0.583 0.307 0.409 3e-14
2499773 412 RecName: Full=46 kDa FK506-binding nucle 0.583 0.211 0.443 4e-14
>gi|312986077|gb|ADR31351.1| FKBP46 [Penaeus monodon] Back     alignment and taxonomy information
 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 57/90 (63%), Gaps = 2/90 (2%)

Query: 1  MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKP-N 59
          MFWG  L+P KRY   V   FHIS A LD  S+TD+E+  +++ V+G ET++CNL K   
Sbjct: 1  MFWGLSLDPAKRYAKVVDDAFHISAAVLDTTSVTDDEIIRVMVEVEGYETLICNLSKKLG 60

Query: 60 YLQERLDLNFIEGNTITL-EVKGKATVHLS 88
           LQ  LDL F+EG+ I    + GK  VHLS
Sbjct: 61 ILQCPLDLQFMEGSRIAFYTLGGKGVVHLS 90

Source: Penaeus monodon

Species: Penaeus monodon

Genus: Penaeus

Family: Penaeidae

Order: Decapoda

Class: Malacostraca

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350412899|ref|XP_003489807.1| PREDICTED: hypothetical protein LOC100749171 [Bombus impatiens] Back     alignment and taxonomy information
>gi|321470537|gb|EFX81513.1| hypothetical protein DAPPUDRAFT_196224 [Daphnia pulex] Back     alignment and taxonomy information
>gi|170046878|ref|XP_001850972.1| 46 kDa FK506-binding nuclear protein [Culex quinquefasciatus] gi|167869480|gb|EDS32863.1| 46 kDa FK506-binding nuclear protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328792386|ref|XP_001121759.2| PREDICTED: hypothetical protein LOC725976 [Apis mellifera] Back     alignment and taxonomy information
>gi|380026681|ref|XP_003697073.1| PREDICTED: uncharacterized protein LOC100869051 [Apis florea] Back     alignment and taxonomy information
>gi|157135619|ref|XP_001663513.1| hypothetical protein AaeL_AAEL003303 [Aedes aegypti] gi|108881175|gb|EAT45400.1| AAEL003303-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|112983564|ref|NP_001037356.1| 45 kDa immunophilin FKBP45 [Bombyx mori] gi|68160236|gb|AAY86706.1| 45 kDa immunophilin FKBP45 [Bombyx mori] Back     alignment and taxonomy information
>gi|332373964|gb|AEE62123.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|2499773|sp|Q26486.1|FKBP4_SPOFR RecName: Full=46 kDa FK506-binding nuclear protein; AltName: Full=Peptidyl-prolyl cis-trans isomerase; Short=PPIase; AltName: Full=Rotamase gi|595845|gb|AAA58962.1| immunophilin FKBP46 [Spodoptera frugiperda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
FB|FBgn0013269 357 FK506-bp1 "FK506-binding prote 0.543 0.226 0.367 4.9e-17
WB|WBGene00001427108 fkb-2 [Caenorhabditis elegans 0.335 0.462 0.452 6.2e-14
UNIPROTKB|Q9U2Q8108 fkb-2 "Peptidyl-prolyl cis-tra 0.335 0.462 0.452 6.2e-14
POMBASE|SPBC1347.02361 fkbp39 "FKBP-type peptidyl-pro 0.389 0.160 0.445 9.6e-13
SGD|S000005079114 FPR1 "Peptidyl-prolyl cis-tran 0.328 0.429 0.423 1.4e-12
UNIPROTKB|Q8F361129 fkpA "Peptidyl-prolyl cis-tran 0.456 0.527 0.388 2.2e-12
ZFIN|ZDB-GENE-030131-7275108 fkbp1aa "FK506 binding protein 0.322 0.444 0.411 2.2e-12
FB|FBgn0013954108 FK506-bp2 "FK506-binding prote 0.322 0.444 0.450 2.8e-12
CGD|CAL0002227124 RBP1 [Candida albicans (taxid: 0.335 0.403 0.415 5.8e-12
UNIPROTKB|P28870124 RBP1 "FK506-binding protein 1" 0.335 0.403 0.415 5.8e-12
FB|FBgn0013269 FK506-bp1 "FK506-binding protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 126 (49.4 bits), Expect = 4.9e-17, Sum P(2) = 4.9e-17
 Identities = 32/87 (36%), Positives = 47/87 (54%)

Query:     1 MFWGFVLEPKKRYNTTVTKPFHISMAALDPKSITDNEVSSLVLNVDGTETILCNLGKPNY 60
             MFWG  ++P+++Y+ T+ K FHIS  ALD       + + L L  +  E I+  + K   
Sbjct:     3 MFWGLNMKPERKYSQTIIKSFHISGVALDK-----GQEAKLYLAAEKQEYIVATVTKA-I 56

Query:    61 LQERLDLNFIEGNTITLEVKGKATVHL 87
              Q  LDLNF +G+ I     G A+V L
Sbjct:    57 PQVALDLNFSKGDRIMFYTAGDASVSL 83
GO:0005528 "FK506 binding" evidence=ISS;NAS;IDA
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA;NAS
GO:0006457 "protein folding" evidence=ISS;NAS
GO:0016242 "negative regulation of macroautophagy" evidence=IMP
GO:0010507 "negative regulation of autophagy" evidence=IMP
GO:0070594 "juvenile hormone response element binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0035626 "juvenile hormone mediated signaling pathway" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0000412 "histone peptidyl-prolyl isomerization" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0005730 "nucleolus" evidence=IBA
GO:0016020 "membrane" evidence=IBA
WB|WBGene00001427 fkb-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9U2Q8 fkb-2 "Peptidyl-prolyl cis-trans isomerase" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPBC1347.02 fkbp39 "FKBP-type peptidyl-prolyl cis-trans isomerase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000005079 FPR1 "Peptidyl-prolyl cis-trans isomerase (PPIase)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|Q8F361 fkpA "Peptidyl-prolyl cis-trans isomerase" [Leptospira interrogans serovar Lai str. 56601 (taxid:189518)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7275 fkbp1aa "FK506 binding protein 1Aa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0013954 FK506-bp2 "FK506-binding protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0002227 RBP1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P28870 RBP1 "FK506-binding protein 1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0CP96FKBP2_CRYNJ5, ., 2, ., 1, ., 80.30460.67780.7163yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 6e-12
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 1e-11
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 7e-05
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score = 57.6 bits (140), Expect = 6e-12
 Identities = 32/85 (37%), Positives = 41/85 (48%), Gaps = 20/85 (23%)

Query: 82  KATVHLSVK-SNNQQFDSS-TQGPGFKFRLGKGEVIKGWDV-----------------DE 122
             TVH + K  +   FDSS  +G  F+F LG G+VI GWD                  + 
Sbjct: 10  TVTVHYTGKLEDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEKRKLTIPPEL 69

Query: 123 EDGNKGS-PPAIPPNSTLVFDVELK 146
             G +G     IPPN+TLVF+VEL 
Sbjct: 70  AYGEEGLAGGVIPPNATLVFEVELL 94

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.95
KOG0544|consensus108 99.94
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.89
KOG0549|consensus188 99.89
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.83
KOG0552|consensus226 99.82
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.81
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.65
KOG0543|consensus 397 99.49
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.3
KOG0543|consensus 397 99.27
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.13
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.12
PF03066149 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 98.7
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 97.79
PRK01490 435 tig trigger factor; Provisional 97.47
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 97.24
KOG0545|consensus 329 94.7
PF01346124 FKBP_N: Domain amino terminal to FKBP-type peptidy 83.11
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.95  E-value=1.3e-28  Score=179.80  Aligned_cols=103  Identities=35%  Similarity=0.522  Sum_probs=95.9

Q ss_pred             eCCceeehhhcCCCCeeeeeeceEE---ecCCeeeeecCCEEEEEEEeec-CCceecCCC-CCCcEEEEecCCcccccce
Q psy4027          45 VDGTETILCNLGKPNYLQERLDLNF---IEGNTITLEVKGKATVHLSVKS-NNQQFDSST-QGPGFKFRLGKGEVIKGWD  119 (149)
Q Consensus        45 ~~~~~~~~~~l~~~~~~~~~~gl~~---~~G~g~~~~~~~~V~vhy~g~~-dG~~fdss~-~~~p~~f~lG~~~~i~G~~  119 (149)
                      .++++|...+.++.++..+++||+|   +.|+|..+..++.|.+||+|++ ||++||||+ +++|+.|.||  ++|+||+
T Consensus        81 ~~~~~f~~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg~p~~f~l~--~vI~Gw~  158 (205)
T COG0545          81 AEGKAFLEKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPGWD  158 (205)
T ss_pred             HhHHHHHhhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccCCCceeecC--CeeehHH
Confidence            3556899999999999999999999   4999999999999999999999 999999999 8999999995  9999999


Q ss_pred             ec-----------------ccccCCCCCCCCCCCCeEEEEEEEEEeC
Q psy4027         120 VD-----------------EEDGNKGSPPAIPPNSTLVFDVELKNVN  149 (149)
Q Consensus       120 ~~-----------------l~yg~~g~~~~ip~~~~l~f~iel~~i~  149 (149)
                      +|                 ||||.+|.++.||||++|+|||||++|+
T Consensus       159 egl~~M~vG~k~~l~IP~~laYG~~g~~g~Ippns~LvFeVeLl~v~  205 (205)
T COG0545         159 EGLQGMKVGGKRKLTIPPELAYGERGVPGVIPPNSTLVFEVELLDVK  205 (205)
T ss_pred             HHHhhCCCCceEEEEeCchhccCcCCCCCCCCCCCeEEEEEEEEecC
Confidence            96                 5999999887799999999999999985

>KOG0544|consensus Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552|consensus Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03066 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF01346 FKBP_N: Domain amino terminal to FKBP-type peptidyl-prolyl isomerase; InterPro: IPR000774 Peptidyl-prolyl cis-trans isomerase (PPIase) catalyses the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 5e-10
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 1e-09
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 1e-08
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 2e-08
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 2e-08
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 2e-08
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 4e-08
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 6e-08
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 7e-08
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 9e-08
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-07
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 4e-07
2ki3_A126 Structural And Biochemical Characterization Of Fk50 7e-07
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 8e-07
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 8e-07
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 8e-07
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 8e-07
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 9e-07
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 1e-06
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 1e-06
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 1e-06
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 1e-06
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 2e-06
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-06
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 2e-06
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-06
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 3e-06
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 3e-06
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-06
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 5e-06
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 5e-06
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 5e-06
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 5e-06
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 6e-06
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 6e-06
2pbc_A102 Fk506-Binding Protein 2 Length = 102 7e-06
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 8e-06
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 1e-05
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 1e-05
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-05
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 3e-05
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 3e-05
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-05
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 2e-04
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (56%), Gaps = 19/86 (22%)
Query: 82  KATVHLSVK-SNNQQFDSS-TQGPGFKFRLGKGEVIKGWD-------VDEED-------- 124
           K TVH   +  + +QFDSS ++G  F+F LG GEVIKGWD       + E+         
Sbjct: 45  KVTVHYDGRFPDGKQFDSSRSRGKPFQFTLGAGEVIKGWDQGVATMTLGEKALFTIPYQL 104
Query: 125 --GNKGSPPAIPPNSTLVFDVELKNV 148
             G +G PP IPP +TLVF+VEL  V
Sbjct: 105 AYGERGYPPVIPPKATLVFEVELLAV 130
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 1e-21
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-21
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-20
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-20
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 6e-20
2ppn_A107 FK506-binding protein 1A; high resolution protein 7e-20
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 4e-19
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 7e-19
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 2e-18
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 2e-18
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 9e-18
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 2e-17
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 3e-17
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 6e-17
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 8e-17
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-16
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-16
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 8e-12
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 2e-16
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-15
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 3e-11
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-11
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 3e-13
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-12
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-07
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 1e-10
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-10
1fd9_A213 Protein (macrophage infectivity potentiator prote; 1e-09
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 5e-08
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-05
1nlq_A108 Nucleoplasmin-like protein; DNLP, chaperone, histo 2e-04
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-04
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
 Score = 82.6 bits (205), Expect = 1e-21
 Identities = 41/99 (41%), Positives = 50/99 (50%), Gaps = 20/99 (20%)

Query: 71  EGNTITLEVKG-KATVHLSVK-SNNQQFDSSTQ-GPGFKFRLGKGEVIKGWD-------V 120
            G+  T    G   T+H +    N Q+FDSS   G  F+  +G G+VIKGWD       V
Sbjct: 15  PGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSV 74

Query: 121 DEED----------GNKGSPPAIPPNSTLVFDVELKNVN 149
            E+           G +G P  IPPNSTLVFDVEL  VN
Sbjct: 75  GEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKVN 113
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1nlq_A Nucleoplasmin-like protein; DNLP, chaperone, histone binding, X-RAY crystallography, ligand binding; 1.50A {Drosophila melanogaster} SCOP: b.121.3.1 Length = 108 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.88
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.86
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.86
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.86
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.85
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.85
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.84
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.84
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.84
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.83
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.83
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.83
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.83
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.82
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.82
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.81
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.8
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.79
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.79
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.78
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.77
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.76
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.75
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.7
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.69
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.69
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.66
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.62
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.46
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.43
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.41
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.33
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.29
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.29
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.27
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.26
1nlq_A108 Nucleoplasmin-like protein; DNLP, chaperone, histo 99.22
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.21
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.08
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 98.94
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 98.88
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 98.76
1xe0_A114 Nucleophosmin; drosophila nucleoplasmin-like prote 98.65
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.54
1k5j_A124 Nucleoplasmin core; beta-barrel, jellyroll, beta-b 98.29
3t30_B110 Nucleoplasmin-2; beta-barrel jelly roll topology, 97.64
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 95.17
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
Probab=99.88  E-value=1.8e-23  Score=155.85  Aligned_cols=100  Identities=25%  Similarity=0.375  Sum_probs=93.0

Q ss_pred             CCceeehhhcCCCCeeeeeeceEE---ecCCeeeeecCCEEEEEEEeec-CCceecCCCCCCcEEEEecCCcccccceec
Q psy4027          46 DGTETILCNLGKPNYLQERLDLNF---IEGNTITLEVKGKATVHLSVKS-NNQQFDSSTQGPGFKFRLGKGEVIKGWDVD  121 (149)
Q Consensus        46 ~~~~~~~~~l~~~~~~~~~~gl~~---~~G~g~~~~~~~~V~vhy~g~~-dG~~fdss~~~~p~~f~lG~~~~i~G~~~~  121 (149)
                      ++++|+..+..+.++..+++||+|   ++|+|..+..++.|.|||+|++ ||++||+|  +.|+.|.+|  ++|+||+++
T Consensus        98 ~~~~fl~~n~~~~gv~~~~sGl~y~vl~~G~G~~p~~gd~V~V~Y~g~l~dG~vfDss--~~P~~f~lG--~vI~G~eea  173 (219)
T 3oe2_A           98 AERTFMAGEKAKPGVKELADGILMTELTPGTGPKPDANGRVEVRYVGRLPDGKIFDQS--TQPQWFRLD--SVISGWTSA  173 (219)
T ss_dssp             HHHHHHHHHHTSTTCEECGGGCEEEEEECCCSCCCCTTSEEEEEEEEECTTSCEEEEC--SSCEEEEGG--GSCHHHHHH
T ss_pred             HHHHHHHHhccCCCcEECCCCeEEEEEecCCCccCCCCCEEEEEEEEEECCCCEeecc--CCcEEEEec--chhHHHHHH
Confidence            457999999999999999999999   4999999999999999999999 99999999  789999995  899999996


Q ss_pred             -----------------ccccCCCCCCCCCCCCeEEEEEEEEEeC
Q psy4027         122 -----------------EEDGNKGSPPAIPPNSTLVFDVELKNVN  149 (149)
Q Consensus       122 -----------------l~yg~~g~~~~ip~~~~l~f~iel~~i~  149 (149)
                                       +|||.+|.++.||||++|+|+|||++|+
T Consensus       174 L~gMk~Gek~~v~IPp~lAYG~~g~~~~IPpnstLvFeVeLl~Ik  218 (219)
T 3oe2_A          174 LQNMPTGAKWRLVIPSDQAYGAEGAGDLIDPFTPLVFEIELIAVS  218 (219)
T ss_dssp             HTTCCTTCEEEEEECGGGTTTTTCBTTTBCTTCCEEEEEEEEEEE
T ss_pred             HhCCCCCCEEEEEECchhcCCCCCCCCCCCCCCeEEEEEEEEEEe
Confidence                             4999999887899999999999999984
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1nlq_A Nucleoplasmin-like protein; DNLP, chaperone, histone binding, X-RAY crystallography, ligand binding; 1.50A {Drosophila melanogaster} SCOP: b.121.3.1 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1xe0_A Nucleophosmin; drosophila nucleoplasmin-like protein (DNLP), nucleoplasmin (NP), histone binding, X-RAY crystallography, chaperone; 1.70A {Xenopus laevis} SCOP: b.121.3.1 PDB: 1xb9_A 2p1b_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1k5j_A Nucleoplasmin core; beta-barrel, jellyroll, beta-bulge, pentamer, chaperone; 2.30A {Xenopus laevis} SCOP: b.121.3.1 PDB: 2vtx_A 2vtx_J Back     alignment and structure
>3t30_B Nucleoplasmin-2; beta-barrel jelly roll topology, histone chaperone, H2A-H2B H3-H4 tetramer, oocytes and early embryos, chaperone; 1.90A {Homo sapiens} SCOP: b.121.3.0 Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1nlqa_105 b.121.3.1 (A:) Chromatin decondensation protein 1 5e-12
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 1e-07
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-07
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-07
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 9e-07
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-06
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-06
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 2e-06
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-06
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 3e-06
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 6e-06
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 3e-05
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 6e-05
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-04
>d1nlqa_ b.121.3.1 (A:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 105 Back     information, alignment and structure

class: All beta proteins
fold: Nucleoplasmin-like/VP (viral coat and capsid proteins)
superfamily: Nucleoplasmin-like core domain
family: Nucleoplasmin-like core domain
domain: Chromatin decondensation protein 1 (Crp1, Nlp)
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 56.5 bits (136), Expect = 5e-12
 Identities = 15/95 (15%), Positives = 27/95 (28%), Gaps = 8/95 (8%)

Query: 2  FWGFVLEPKKRYNT-------TVTKPFHISMAALDPK-SITDNEVSSLVLNVDGTETILC 53
          F+G  L  +    T          +   I    L  +    +  V  +    D  +  + 
Sbjct: 4  FYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIA 63

Query: 54 NLGKPNYLQERLDLNFIEGNTITLEVKGKATVHLS 88
           L          D+ F E       +KG   V++ 
Sbjct: 64 VLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIH 98
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.91
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.91
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.87
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.87
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.87
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.86
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.86
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.85
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.84
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.67
d1nlqa_105 Chromatin decondensation protein 1 (Crp1, Nlp) {Fr 99.64
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.53
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.31
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.1
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.1
d1xe0a_108 Nucleophosmin (NO38) {African clawed frog (Xenopus 98.06
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 97.98
d1k5ja_105 Nucleoplasmin core {Xenopus laevis [TaxId: 8355]} 97.92
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]

Probab=99.91  E-value=6.1e-26  Score=166.28  Aligned_cols=102  Identities=26%  Similarity=0.419  Sum_probs=94.1

Q ss_pred             CCceeehhhcCCCCeeeeeeceEE---ecCCeeeeecCCEEEEEEEeec-CCceecCCC-CCCcEEEEecCCccccccee
Q psy4027          46 DGTETILCNLGKPNYLQERLDLNF---IEGNTITLEVKGKATVHLSVKS-NNQQFDSST-QGPGFKFRLGKGEVIKGWDV  120 (149)
Q Consensus        46 ~~~~~~~~~l~~~~~~~~~~gl~~---~~G~g~~~~~~~~V~vhy~g~~-dG~~fdss~-~~~p~~f~lG~~~~i~G~~~  120 (149)
                      .+++|+..+..+.++..+++||+|   ++|+|..+..++.|.|||+|++ ||++||+|+ ++.|+.|.+  +++|+||++
T Consensus        79 ~~~~fl~~~~~~~~v~~~~sGl~y~v~~~G~G~~p~~~d~v~v~y~g~l~dg~~f~~s~~~~~p~~~~~--~~~i~G~~e  156 (204)
T d1fd9a_          79 KGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQV--SQVIPGWTE  156 (204)
T ss_dssp             HHHHHHHHHHHSTTEEECTTSCEEEEEECCCSCCCCTTCEEEEEEEEEETTSCEEEEHHHHCSCEEEEG--GGSCHHHHH
T ss_pred             HHHHHHHhcccCCceEEecCccEEEEeecCCCcccCCCCEEEEEEEEEECCCCEecccccCCCCceecC--CccchhHHH
Confidence            456899999888899999999999   5999999999999999999999 999999998 788999988  679999999


Q ss_pred             c-----------------ccccCCCCCCCCCCCCeEEEEEEEEEeC
Q psy4027         121 D-----------------EEDGNKGSPPAIPPNSTLVFDVELKNVN  149 (149)
Q Consensus       121 ~-----------------l~yg~~g~~~~ip~~~~l~f~iel~~i~  149 (149)
                      +                 ||||.+|.++.||||++|+|+|||++|+
T Consensus       157 ~l~~m~~G~~~~~~iP~~laYG~~g~~~~Ipp~s~l~feveL~~i~  202 (204)
T d1fd9a_         157 ALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVK  202 (204)
T ss_dssp             HHTTCCTTCEEEEEECGGGTTTTCCCSSSCCTTCCEEEEEEEEEEE
T ss_pred             HhcCCCCCCEEEEEEChHHCcCCCCCCCCcCcCCcEEEEEEEEEEE
Confidence            6                 5999999988899999999999999984
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nlqa_ b.121.3.1 (A:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xe0a_ b.121.3.1 (A:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k5ja_ b.121.3.1 (A:) Nucleoplasmin core {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure