Diaphorina citri psyllid: psy4032

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MMGVSLLAQAMLGPVGVISMGGAAPNGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
ccHHHHHHHHHccccEEEEcccccccccccccccccccccccEEEEcEEEcccccccHHHHHHHHHHHHHHHHHcHHHHHHHcc
*MGVSLLAQAMLGPVGVISMGGAAPNGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWY**
xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMGVSLLAQAMLGPVGVISMGGAAPNGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH-quinone oxidoreductase subunit B NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.confidentQ1LPW2
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ9DC70
NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ54NI6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097060 [CC]synaptic membraneprobableGO:0005575, GO:0044456, GO:0016020, GO:0045202
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0003954 [MF]NADH dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0005747 [CC]mitochondrial respiratory chain complex IprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045271, GO:0032991, GO:0043231, GO:0030964, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0032981 [BP]mitochondrial respiratory chain complex I assemblyprobableGO:0006996, GO:0033108, GO:0044699, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0097031, GO:0006461, GO:0010257, GO:0016043, GO:0065003, GO:0044085, GO:0044763, GO:0071840, GO:0034622, GO:0008150, GO:0009987, GO:0043623, GO:0007005

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.99.-With other acceptors.probable
1.6.99.5NADH dehydrogenase (quinone).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I9V, chain 6
Confidence level:very confident
Coverage over the Query: 2-83
View the alignment between query and template
View the model in PyMOL