Diaphorina citri psyllid: psy4039


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
MSLRTLLFRFYHNGKLLVRYIKPLQPGHKIEFLTQPPATSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTNRVTNSMASDLRRKTLQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERVLLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKPLV
ccHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccccccHHccHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccHHHHccccccccccccccccccccHHHHHHHHHHHHccccccccHHcccccccccccccccccHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEcccEEEEEEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccEEEEEEEECcccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccc
*SLRTLLFRFYHNGKLLVRYIKPLQPGHKIEFL*******************PIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTNRVTNSMASDLRRKTLQQLLYKDNSKPFLAFVGVSLASGTGILTK***FE***************************DVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERVLLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKP*V
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLRTLLFRFYHNGKLLVRYIKPLQPGHKIEFLTQPPATSSGQGRLSAPAGHPIQTYFQNARKLFVNSLLNRVTNSMASDLRRKTIQQLLYKDNSKPFLAFVGVSLASGTGILTNRVTNSMASDLRRKTLQQLLYKDNSKPFLAFVGVSLASGTGILTKEDEFEGVCWEIRHAVNNMFDKLVQVETLPDVDDVKVDDIQIGKFIAKGTNAVVYEATFRGVEYALKMMFNYSAASNSHAILKAMSKELLPLRKPLRLNEDMLMNSVENLPPHPNVVVMHFAFTDFVPSIPDSSLIYPSALPARLNPTGGYGRNMSLFILMKKYNTDLRNYLRERCAQLSMHERVLLFTQLLEGVTHLNMHRTAHRDLKSDNILLDCSEDNTCPQLVITDFGSSYTNKSGLSMQYSSADIELGGNVALMAPEVALATPGLFSFVNYSKSDAWTAGTVAYEIFGHDNPFYQSARNTDYEVNALPQLNTNVPEVMRRLVAKLLENDPSDRPSAELAATVCQLYLWAPKHWLYGATPSHNEIMQWLLTLTTKVLCTGVSYGGHVRRTFVEYQLISTFLKRAEFRLITNALQYIQRVLTPKPLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase PINK1, mitochondrial Protects against mitochondrial dysfunction during cellular stress, potentially by phosphorylating mitochondrial proteins (By similarity). Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy) (By similarity). It is necessary for PARK2 recruitment to dysfunctional mitochondria to initiate their degradation.confidentQ99MQ3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LL6, chain A
Confidence level:very confident
Coverage over the Query: 209-238,251-287,308-399,424-456,469-511
View the alignment between query and template
View the model in PyMOL
Template: 2ZV2, chain A
Confidence level:very confident
Coverage over the Query: 193-230,253-285,312-518
View the alignment between query and template
View the model in PyMOL
Template: 3Q5I, chain A
Confidence level:very confident
Coverage over the Query: 195-229,250-285,314-581
View the alignment between query and template
View the model in PyMOL
Template: 2VUW, chain A
Confidence level:very confident
Coverage over the Query: 193-398,409-518
View the alignment between query and template
View the model in PyMOL
Template: 2R5T, chain A
Confidence level:confident
Coverage over the Query: 57-106
View the alignment between query and template
View the model in PyMOL