Diaphorina citri psyllid: psy4050

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--
MKRLCPEISFFQQAAEYPCKAVVTSGGRKRLHRRVTHSTLSSANVQRRGLGVTKQAAEYPCKAVVTSGGRKRLHRRVTHSTLSSANVQRRGLGVTKIALVVRKAAEDYAPLEEGREAHWEVVERLLFLYAKMNPGQGYVQGMNEIIGPIYYTFATDPVLENRVRKAAEDYAPLEEGREAHWEVVERLLFLYAKMNPGQGYVQGMNEIIGPIYYTFATDPVLDNREHAEADCFFVFTNLMGEIRDFFIKSLDETESGINRLMSKLNQTMKQKDLEVWEKLYAIELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSLFADELRFSFLNHICCAMILLVREDILAGDFPSIVKLLQHYPSSVDIPTVISKAVELAGREKVHHISLYPKKLITHCALSLLCLPVYTAVYYTGDLIADELRFSFLNHICCAMILLVREDILAGDFPSIVKLLQHYPSSVDIPTVISKAVELAGRELLG
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccEEHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHcccc
*KRLCPEISFFQQAAEYPCKAVV*********************************AEYPCKAVVTSGGR**L****THSTLS*****RRGLGVTKIALVVRKAAEDYAPLEEGREAHWEVVERLLFLYAKMNPGQGYVQGMNEIIGPIYYTFATDPVLENRVRKAAEDYAPLEEGREAHWEVVERLLFLYAKMNPGQGYVQGMNEIIGPIYYTFATDPVLDNREHAEADCFFVFTNLMGEIRDFFIKSLDETESGINRLMSKLNQTMKQKDLEVWEKLYAIELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSLFADELRFSFLNHICCAMILLVREDILAGDFPSIVKLLQHYPSSVDIPTVISKAVELAGREKVHHISLYPKKLITHCALSL*******************LRFSFLNHICCAMILLVREDILAGDFPSIVKLLQHYPSSVDIPTVISKAVELAGREL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRLCPEISFFQQAAEYPCKAVVTSGGRKRLHRRVTHSTLSSANVQRRGLGVTKQAAEYPCKAVVTSGGRKRLHRRVTHSTLSSANVQRRGLGVTKIALVVRKAAEDYAPLEEGREAHWEVVERLLFLYAKMNPGQGYVQGMNEIIGPIYYTFATDPVLENRVRKAAEDYAPLEEGREAHWEVVERLLFLYAKMNPGQGYVQGMNEIIGPIYYTFATDPVLDNREHAEADCFFVFTNLMGEIRDFFIKSxxxxxxxxxxxxxxxxxxxxxKDLEVWEKLYAIELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSLFADELRFSFLNHICCAMILLVREDILAGDFPSIVKLLQHYPSSVDIPTVISKAVELAGREKVHHISLYPKKLITHCALSLLCLPVYTAVYYTGDLIADELRFSFLNHICCAMILLVREDILAGDFPSIVKLLQHYPSSVDIPTVISKAVELAGRELLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TBC1 domain family member 13 May act as a GTPase-activating protein for Rab family protein(s).confidentQ8R3D1
TBC1 domain family member 13 May act as a GTPase-activating protein for Rab family protein(s).confidentQ9NVG8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001514 [BP]selenocysteine incorporationprobableGO:0006451, GO:0080090, GO:0019222, GO:0051246, GO:0031323, GO:0044249, GO:0034645, GO:0050789, GO:0044267, GO:0044260, GO:0010608, GO:2000112, GO:0071704, GO:0010467, GO:0065007, GO:0031326, GO:0010468, GO:1901576, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0044238, GO:0032268, GO:0019538, GO:0044237, GO:0043170, GO:0010556, GO:0006417, GO:0006414, GO:0006412

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FKM, chain A
Confidence level:very confident
Coverage over the Query: 158-318
View the alignment between query and template
View the model in PyMOL
Template: 3QWL, chain A
Confidence level:very confident
Coverage over the Query: 93-216,227-374
View the alignment between query and template
View the model in PyMOL
Template: 1FKM, chain A
Confidence level:very confident
Coverage over the Query: 414-468
View the alignment between query and template
View the model in PyMOL