Diaphorina citri psyllid: psy4053


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKSSL
ccEEEEEEEEEEEEEEEcEEEcCCccccccccccCEEEEEEEccccccccccEEEEEEEccccccccccccccc
*NIEYVVNQVHGVEIHEGVGFESLLP*********IGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKSSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-methionine sulfoxide oxidase mical3b Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process.confidentF1QWK4
Protein-methionine sulfoxide oxidase mical3a Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process.confidentF1QH17
Protein-methionine sulfoxide oxidase MICAL3 Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process.confidentG3MWR8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070995 [BP]NADPH oxidationprobableGO:0006739, GO:0006732, GO:0006733, GO:0034641, GO:0006807, GO:0046496, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0071704, GO:0055086, GO:0044281, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055114, GO:0046483, GO:0044238, GO:1901564, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0019362
GO:0019417 [BP]sulfur oxidationprobableGO:0044710, GO:0009987, GO:0044237, GO:0006790, GO:0008152, GO:0008150, GO:0055114
GO:0043914 [MF]NADPH:sulfur oxidoreductase activityprobableGO:0003824, GO:0003674, GO:0016491
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BRY, chain A
Confidence level:very confident
Coverage over the Query: 11-71
View the alignment between query and template
View the model in PyMOL