Psyllid ID: psy4053

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70----
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKSSL
ccEEEEEEEEEEEEEEEcEEEcEEccccccccccEEEEEEEEccccccccccEEEEEEEccccccccccccccc
ccEEEEEEEEEEEEEEEEEEEEcccccccccccccEEEEEEEcccccccccEEEEEEEEccccccccccccccc
MNIEYVVNQVHGVeihegvgfesllpppsnqdeekigwravvsppdhpvsqyeFNVLvgadgkrntlegfkssl
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKSSL
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKSSL
***EYVVNQVHGVEIHEGVGFES************IGWRAVV******VSQYEFNVLVG***************
*NIEYVVNQVHGVEIHEGVGFESLLP***********W*AVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKS**
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKSSL
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiii
iiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIEYVVNQVHGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFKSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query74 2.2.26 [Sep-21-2011]
Q8CJ19 1993 Protein-methionine sulfox no N/A 0.810 0.030 0.6 3e-17
Q7RTP6 2002 Protein-methionine sulfox no N/A 0.810 0.029 0.6 4e-17
G3MWR8 1960 Protein-methionine sulfox yes N/A 0.810 0.030 0.6 8e-17
F1MF74 1101 Protein-methionine sulfox no N/A 0.932 0.062 0.536 3e-16
O94851 1124 Protein-methionine sulfox no N/A 0.810 0.053 0.583 3e-16
F1QWK4 1673 Protein-methionine sulfox yes N/A 0.797 0.035 0.6 1e-15
F1QH17 1994 Protein-methionine sulfox yes N/A 0.810 0.030 0.566 1e-15
Q8BML1 960 Protein-methionine sulfox no N/A 0.810 0.062 0.55 1e-15
D4A1F2 961 Protein-methionine sulfox no N/A 0.810 0.062 0.566 4e-15
Q86BA1 4723 Protein-methionine sulfox no N/A 0.716 0.011 0.596 1e-12
>sp|Q8CJ19|MICA3_MOUSE Protein-methionine sulfoxide oxidase MICAL3 OS=Mus musculus GN=Mical3 PE=1 SV=2 Back     alignment and function desciption
 Score = 87.4 bits (215), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 48/60 (80%)

Query: 12  GVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFK 71
           G+EIH  V F+ L+ PP +Q+ E+IGWRA+V P  HPVS+YEF V++G DG+RNTLEGF+
Sbjct: 174 GIEIHVNVEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFR 233
Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. Acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization. Involved in exocytic vesicles tethering and fusion: the monooxygenase activity is required for this process.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: -
>sp|Q7RTP6|MICA3_HUMAN Protein-methionine sulfoxide oxidase MICAL3 OS=Homo sapiens GN=MICAL3 PE=1 SV=2 Back     alignment and function description
>sp|G3MWR8|MICA3_BOVIN Protein-methionine sulfoxide oxidase MICAL3 OS=Bos taurus GN=MICAL3 PE=3 SV=1 Back     alignment and function description
>sp|F1MF74|MICA2_BOVIN Protein-methionine sulfoxide oxidase MICAL2 OS=Bos taurus GN=MICAL2 PE=3 SV=2 Back     alignment and function description
>sp|O94851|MICA2_HUMAN Protein-methionine sulfoxide oxidase MICAL2 OS=Homo sapiens GN=MICAL2 PE=1 SV=1 Back     alignment and function description
>sp|F1QWK4|MCA3B_DANRE Protein-methionine sulfoxide oxidase mical3b OS=Danio rerio GN=mical3b PE=2 SV=2 Back     alignment and function description
>sp|F1QH17|MCA3A_DANRE Protein-methionine sulfoxide oxidase mical3a OS=Danio rerio GN=mical3a PE=2 SV=2 Back     alignment and function description
>sp|Q8BML1|MICA2_MOUSE Protein-methionine sulfoxide oxidase MICAL2 OS=Mus musculus GN=Mical2 PE=1 SV=1 Back     alignment and function description
>sp|D4A1F2|MICA2_RAT Protein-methionine sulfoxide oxidase MICAL2 OS=Rattus norvegicus GN=Mical2 PE=2 SV=1 Back     alignment and function description
>sp|Q86BA1|MICAL_DROME Protein-methionine sulfoxide oxidase Mical OS=Drosophila melanogaster GN=Mical PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
242007332 803 protein MICAL-3, putative [Pediculus hum 0.810 0.074 0.8 4e-24
383858301 2677 PREDICTED: protein-methionine sulfoxide 0.810 0.022 0.766 4e-21
328706346 2222 PREDICTED: hypothetical protein LOC10016 0.851 0.028 0.753 6e-21
340716919 2677 PREDICTED: hypothetical protein LOC10065 0.810 0.022 0.75 1e-20
350426821 2672 PREDICTED: hypothetical protein LOC10074 0.810 0.022 0.733 3e-20
322780790 3356 hypothetical protein SINV_01679 [Solenop 0.810 0.017 0.75 4e-20
328776125 2655 PREDICTED: hypothetical protein LOC41331 0.810 0.022 0.733 6e-20
307186691 733 Protein MICAL-3 [Camponotus floridanus] 0.810 0.081 0.716 8e-20
380016801 3136 PREDICTED: uncharacterized protein LOC10 0.810 0.019 0.716 1e-19
427779999 824 Putative protein-methionine sulfoxide ox 0.797 0.071 0.711 8e-19
>gi|242007332|ref|XP_002424495.1| protein MICAL-3, putative [Pediculus humanus corporis] gi|212507913|gb|EEB11757.1| protein MICAL-3, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 56/60 (93%)

Query: 12  GVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFK 71
           GVEIHEGV F+SL+PPP+NQD EK GW+A+V+P DHPVSQYEF+VL+GADGKRNTLEGFK
Sbjct: 176 GVEIHEGVAFDSLIPPPANQDTEKTGWKALVTPSDHPVSQYEFDVLIGADGKRNTLEGFK 235

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383858301|ref|XP_003704640.1| PREDICTED: protein-methionine sulfoxide oxidase Mical-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328706346|ref|XP_001949334.2| PREDICTED: hypothetical protein LOC100168266 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340716919|ref|XP_003396938.1| PREDICTED: hypothetical protein LOC100650962 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350426821|ref|XP_003494553.1| PREDICTED: hypothetical protein LOC100744389 [Bombus impatiens] Back     alignment and taxonomy information
>gi|322780790|gb|EFZ10019.1| hypothetical protein SINV_01679 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328776125|ref|XP_396755.4| PREDICTED: hypothetical protein LOC413310 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307186691|gb|EFN72163.1| Protein MICAL-3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380016801|ref|XP_003692361.1| PREDICTED: uncharacterized protein LOC100869779 [Apis florea] Back     alignment and taxonomy information
>gi|427779999|gb|JAA55451.1| Putative protein-methionine sulfoxide oxidase mical3 [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
UNIPROTKB|E9PP85335 MICAL3 "Protein-methionine sul 0.810 0.179 0.6 6.8e-18
UNIPROTKB|E9PTS8 826 E9PTS8 "Uncharacterized protei 0.810 0.072 0.6 1.2e-16
UNIPROTKB|E1BXR9 899 Gga.14596 "Uncharacterized pro 0.810 0.066 0.6 2.2e-16
UNIPROTKB|Q7RTP6 2002 MICAL3 "Protein-methionine sul 0.810 0.029 0.6 3e-16
UNIPROTKB|F1Q009 1821 MICAL3 "Uncharacterized protei 0.810 0.032 0.6 3.4e-16
UNIPROTKB|F1SHR1 1949 MICAL3 "Uncharacterized protei 0.810 0.030 0.6 3.7e-16
MGI|MGI:2442733 1993 Mical3 "microtubule associated 0.810 0.030 0.6 3.8e-16
UNIPROTKB|F1Q0K3 2016 MICAL3 "Uncharacterized protei 0.810 0.029 0.6 3.9e-16
UNIPROTKB|G3MWR8 1960 MICAL3 "Protein-methionine sul 0.810 0.030 0.6 6.1e-16
UNIPROTKB|E1C3Y4 858 E1C3Y4 "Uncharacterized protei 0.810 0.069 0.6 7.1e-16
UNIPROTKB|E9PP85 MICAL3 "Protein-methionine sulfoxide oxidase MICAL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 6.8e-18, P = 6.8e-18
 Identities = 36/60 (60%), Positives = 48/60 (80%)

Query:    12 GVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLEGFK 71
             G+EIH  V F+ L+ PP +Q+ E+IGWRA+V P  HPVS+YEF V++G DG+RNTLEGF+
Sbjct:   174 GIEIHVNVEFQGLIQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFR 233
GO:0016491 "oxidoreductase activity" evidence=IEA
UNIPROTKB|E9PTS8 E9PTS8 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXR9 Gga.14596 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q7RTP6 MICAL3 "Protein-methionine sulfoxide oxidase MICAL3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q009 MICAL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHR1 MICAL3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2442733 Mical3 "microtubule associated monooxygenase, calponin and LIM domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0K3 MICAL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MWR8 MICAL3 "Protein-methionine sulfoxide oxidase MICAL3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3Y4 E1C3Y4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F1QH17MCA3A_DANRE1, ., 1, 4, ., 1, 3, ., -0.56660.81080.0300yesN/A
F1QWK4MCA3B_DANRE1, ., 1, 4, ., 1, 3, ., -0.60.79720.0352yesN/A
G3MWR8MICA3_BOVIN1, ., 1, 4, ., 1, 3, ., -0.60.81080.0306yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 74
PRK07588 391 hypothetical protein; Provisional 96.54
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.32
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.26
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.1
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 95.93
PRK05868 372 hypothetical protein; Validated 95.82
PRK06475 400 salicylate hydroxylase; Provisional 95.79
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.65
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 95.46
PRK11445 351 putative oxidoreductase; Provisional 95.36
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.34
PRK08244 493 hypothetical protein; Provisional 95.22
PRK08013 400 oxidoreductase; Provisional 95.12
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 95.08
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.08
PRK09126 392 hypothetical protein; Provisional 95.07
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 94.92
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.88
PRK07045 388 putative monooxygenase; Reviewed 94.86
PRK06126 545 hypothetical protein; Provisional 94.59
PRK07236 386 hypothetical protein; Provisional 94.58
PRK06847 375 hypothetical protein; Provisional 94.51
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 94.14
PRK08132 547 FAD-dependent oxidoreductase; Provisional 93.99
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.94
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 93.88
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 93.88
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 93.88
PRK06996 398 hypothetical protein; Provisional 93.74
PRK06184 502 hypothetical protein; Provisional 93.54
PRK08163 396 salicylate hydroxylase; Provisional 93.5
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 93.04
PRK06834 488 hypothetical protein; Provisional 92.84
PRK06753 373 hypothetical protein; Provisional 92.76
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 92.72
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 92.65
PRK07538 413 hypothetical protein; Provisional 92.5
PRK07190 487 hypothetical protein; Provisional 92.47
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 91.95
PRK08294 634 phenol 2-monooxygenase; Provisional 91.93
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 91.62
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 89.71
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 88.9
PF03074 371 GCS: Glutamate-cysteine ligase; InterPro: IPR00430 88.0
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 85.06
PRK06185 407 hypothetical protein; Provisional 84.75
KOG3754|consensus 640 83.56
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information 
Probab=96.54  E-value=0.0065  Score=44.87  Aligned_cols=47  Identities=19%  Similarity=0.263  Sum_probs=36.2

Q ss_pred             EeEEEeeCceeceeeCCCCCCCcCceeeEEEEcCCCCCCCccEEeEEEecCCCccccC
Q psy4053          11 HGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTLE   68 (74)
Q Consensus        11 LGVeIH~~V~F~~L~eP~~~~~~~~~GWra~~~P~~h~ls~~eFdvlIgAdG~rn~l~   68 (74)
                      -|++||.+.+..++....       .+|++.+.-.    ...++|+||||||.++...
T Consensus       115 ~~v~i~~~~~v~~i~~~~-------~~v~v~~~~g----~~~~~d~vIgADG~~S~vR  161 (391)
T PRK07588        115 GQVETIFDDSIATIDEHR-------DGVRVTFERG----TPRDFDLVIGADGLHSHVR  161 (391)
T ss_pred             cCeEEEeCCEEeEEEECC-------CeEEEEECCC----CEEEeCEEEECCCCCccch
Confidence            479999999999986422       2688887632    3468999999999988763

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF03074 GCS: Glutamate-cysteine ligase; InterPro: IPR004308 This family represents the catalytic subunit of glutamate-cysteine ligase (6 Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG3754|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
2bra_A 484 Structure Of N-Terminal Fad Binding Motif Of Mouse 6e-08
2bry_A 497 Crystal Structure Of The Native Monooxygenase Domai 6e-08
>pdb|2BRA|A Chain A, Structure Of N-Terminal Fad Binding Motif Of Mouse Mical Length = 484 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 34/60 (56%), Gaps = 5/60 (8%)
Query: 12  GVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSP-PDHPVSQYEFNVLVGADGKRNTLEGF 70
           GVEIH GV F  L PPP        GWRA + P P   ++ YEF+VL+ A G +   EGF
Sbjct: 172 GVEIHWGVKFTGLQPPPRKGS----GWRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGF 227
>pdb|2BRY|A Chain A, Crystal Structure Of The Native Monooxygenase Domain Of Mical At 1.45 A Resolution Length = 497 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
2bry_A 497 NEDD9 interacting protein with calponin homology a 9e-18
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Length = 497 Back     alignment and structure
 Score = 74.4 bits (182), Expect = 9e-18
 Identities = 27/61 (44%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 12  GVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDH-PVSQYEFNVLVGADGKRNTLEGF 70
           GVEIH GV F  L PPP        GWRA + P     ++ YEF+VL+ A G +   EGF
Sbjct: 180 GVEIHWGVKFTGLQPPPRKGS----GWRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGF 235

Query: 71  K 71
            
Sbjct: 236 T 236

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
2bry_A 497 NEDD9 interacting protein with calponin homology a 95.99
4hb9_A 412 Similarities with probable monooxygenase; flavin, 95.44
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 95.28
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 95.25
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 95.16
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 95.1
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 94.99
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 94.99
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 94.6
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 94.11
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 93.94
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 93.87
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 93.87
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 92.72
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 92.47
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 92.39
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 91.58
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 90.48
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 90.21
3atr_A 453 Conserved archaeal protein; saturating double bond 89.4
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 88.52
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 86.66
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 86.23
2ywl_A180 Thioredoxin reductase related protein; uncharacter 85.42
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 85.05
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 84.42
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 83.34
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 82.53
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 82.17
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
Probab=95.99  E-value=0.0045  Score=46.68  Aligned_cols=57  Identities=47%  Similarity=0.858  Sum_probs=43.0

Q ss_pred             EeEEEeeCceeceeeCCCCCCCcCceeeEEEEcCC-CCCCCccEEeEEEecCCCccccCCcc
Q psy4053          11 HGVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPP-DHPVSQYEFNVLVGADGKRNTLEGFK   71 (74)
Q Consensus        11 LGVeIH~~V~F~~L~eP~~~~~~~~~GWra~~~P~-~h~ls~~eFdvlIgAdG~rn~l~GF~   71 (74)
                      .||+|+.+.+.+++..-..+.    .+|.+.+... +.....++.|.||+|||.++.+.++.
T Consensus       179 ~gv~v~~~~~v~~i~~~~~~~----~~~~v~~~~~~~g~~~~i~ad~VV~A~G~~S~~r~~~  236 (497)
T 2bry_A          179 LGVEIHWGVKFTGLQPPPRKG----SGWRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGFT  236 (497)
T ss_dssp             TTCEEEESCEEEEEECCCSTT----CCBEEEEESCCCHHHHTCCBSEEEECCCTTCCCTTCE
T ss_pred             CCCEEEeCCEEEEEEEecCCC----CEEEEEEEECCCCCEEEEEcCEEEECCCCCccccccc
Confidence            589999999999997532222    3699988654 44334588999999999999887653
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.19
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 90.22
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.76
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 88.12
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 83.85
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monooxygenase PhzS
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=93.19  E-value=0.018  Score=35.80  Aligned_cols=49  Identities=20%  Similarity=0.201  Sum_probs=35.3

Q ss_pred             eEEEeeCceeceeeCCCCCCCcCceeeEEEEcCCCCCCCccEEeEEEecCCCcccc
Q psy4053          12 GVEIHEGVGFESLLPPPSNQDEEKIGWRAVVSPPDHPVSQYEFNVLVGADGKRNTL   67 (74)
Q Consensus        12 GVeIH~~V~F~~L~eP~~~~~~~~~GWra~~~P~~h~ls~~eFdvlIgAdG~rn~l   67 (74)
                      +++++.+.++..+.+-.       .++.+.+.-.+.....++.|.+|||||.++.+
T Consensus       120 ~~~~~~~~~v~~~~~~~-------~~v~v~~~~g~~~~~~~~ad~vi~ADG~~S~v  168 (288)
T d3c96a1         120 QQAVRTGLGVERIEERD-------GRVLIGARDGHGKPQALGADVLVGADGIHSAV  168 (288)
T ss_dssp             TTSEEESEEEEEEEEET-------TEEEEEEEETTSCEEEEEESEEEECCCTTCHH
T ss_pred             CeeeecCcEEEEeeecC-------CcEEEEEEcCCCCeEEEeeceeeccCCcccee
Confidence            45667777777665411       26777777666666788999999999998764
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure