Diaphorina citri psyllid: psy4056


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MNKILQTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
cccccccHHHHHHHHHHHHHHHHHHEEEECccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHcccccccHHHHHHHHHHEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcc
********RHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPD***********KVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
xxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKILQTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized aarF domain-containing protein kinase 1 The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).confidentQ5ZMT7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044434 [CC]chloroplast partprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y7J, chain A
Confidence level:confident
Coverage over the Query: 146-190
View the alignment between query and template
View the model in PyMOL
Template: 2OLC, chain A
Confidence level:probable
Coverage over the Query: 129-213
View the alignment between query and template
View the model in PyMOL